KEGG   Escherichia coli NA114 (UPEC): ECNA114_2938
Entry
ECNA114_2938      CDS       T01998                                 

Gene name
ygfX
Definition
(GenBank) hypothetical protein
  KO
K19168  toxin CptA
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ena02048]
    ECNA114_2938 (ygfX)
Prokaryotic defense system [BR:ena02048]
 Toxin-antitoxin system (TA system)
  Type IV TA system
   CptA-CptB
    ECNA114_2938 (ygfX)
SSDB
Motif
Pfam: Cpta_toxin
Other DBs
NCBI-ProteinID: AEG37775
Position
complement(3025716..3026123)
AA seq 135 aa
MVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRI
NARQGEIRLLMDGRLRWQGQEWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAE
WRDLRRILLQQETQR
NT seq 408 nt   +upstreamnt  +downstreamnt
gtggtcctgtggcaatctgatttgcgcgtctcctggcgcgcacagtggctttccttgctg
attcatgggctggttgccgctgttattttactcattccctggccgctcagttacaccccg
ttatggatggtgttactttcgctggtggtgtttgattgcgttcgcagccagcggcgcatt
aatgctcgccagggggaaattcgcttgttgatggacgggcgtttgcgttggcaagggcag
gagtggagcatcgtcaaagcgccgtggatgattaagagcggcatgatgctgcgtttacgt
tctgacagcggaaaacggcaacatttatggctggcagctgacagcatggacgaagccgaa
tggcgggatttacggcggatattgttgcaacaagagacgcaaagataa

DBGET integrated database retrieval system