KEGG   Escherichia coli NA114 (UPEC): ECNA114_2939
Entry
ECNA114_2939      CDS       T01998                                 

Gene name
ygfY
Definition
(GenBank) hypothetical protein
  KO
K09159  antitoxin CptB
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:ena02048]
    ECNA114_2939 (ygfY)
Prokaryotic defense system [BR:ena02048]
 Toxin-antitoxin system (TA system)
  Type IV TA system
   CptA-CptB
    ECNA114_2939 (ygfY)
SSDB
Motif
Pfam: Sdh5 YbjN DUF866
Other DBs
NCBI-ProteinID: AEG37776
Structure
PDB: 
1X6I 1X6J 6C12 6B58

Position
complement(3026104..3026370)
AA seq 88 aa
MDINNKARIHWACRRGMRELDISIMPFFEHEYDSLSDDEKRTFIRLLECDDPDLFNWLMN
HGKPADAELEMMVRLIQTRNRERGPVAI
NT seq 267 nt   +upstreamnt  +downstreamnt
atggacattaacaacaaagcccgcattcattgggcatgccgccgtggtatgcgcgaactc
gatatttcaatcatgccgtttttcgaacatgagtacgacagcttaagcgatgacgaaaaa
cgcacctttattcgtctgctggaatgtgacgatccggacctgtttaactggctgatgaat
cacggtaaaccagccgatgcagaactggaaatgatggtccgactcatccagacacggaac
cgggaacgtggtcctgtggcaatctga

DBGET integrated database retrieval system