KEGG   Escherichia coli NA114 (UPEC): ECNA114_2940
Entry
ECNA114_2940      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Other DBs
NCBI-ProteinID: AEG37777
Position
3026414..3026539
AA seq 41 aa
MFFDFFYGNISKHNRDREINSQQFKGFIFLEVASQKAQIAQ
NT seq 126 nt   +upstreamnt  +downstreamnt
gtgtttttcgacttcttttacgggaatatcagtaaacacaatcgcgatcgcgaaattaat
tcacaacaattcaagggcttcatttttttggaagtcgcctcgcagaaggcacagatcgcg
cagtga

DBGET integrated database retrieval system