KEGG   Escherichia coli NA114 (UPEC): ECNA114_2941
Entry
ECNA114_2941      CDS       T01998                                 

Gene name
ygfZ
Definition
(GenBank) hypothetical protein
  KO
K06980  tRNA-modifying protein YgfZ
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ena03016]
    ECNA114_2941 (ygfZ)
Transfer RNA biogenesis [BR:ena03016]
 Prokaryotic type
  tRNA modification factors
   Thiolation factors
    ECNA114_2941 (ygfZ)
SSDB
Motif
Pfam: GCV_T Sortase Peptidase_S41_N
Other DBs
NCBI-ProteinID: AEG37778
Structure
PDB: 
1VLY 1NRK

Position
3026613..3027593
AA seq 326 aa
MAFTPFPPRQPTASARLPLTLMTLDDWALATITGADSEKYMQGQVTADVSQMTEDQHLLA
AHCDAKGKMWSNLRLFRDGDGFAWIERRSVREPQLTELKKYAVFSKVTIAPDDERVLLGV
AGFQARTALANLFSELPSREKQVVKEGATTLLWFEHPAERFLIVTDEATANMLTDKLRGE
AELNNSQQWLALNIEAGFPVIDAANSGQFIPQATNLQALGGISFKKGCYTGQEMVARAKF
RGANKRALWLLTGSASRLPEAGEDLELKMGENWRRTGTVLAAVKLEDGQVVVQVVMNNDM
EPDSIFRVRDDANTLRIEPLPYSLEE
NT seq 981 nt   +upstreamnt  +downstreamnt
atggcttttacaccttttcctccccgtcagcctacggcttctgcccgtttgccactgacg
ctgatgacgcttgatgactgggcgcttgccactattactggcgcggacagcgaaaaatat
atgcaaggccaggtgacagcagatgtcagccagatgactgaagatcagcacctgctcgcc
gcccattgcgacgccaaaggtaaaatgtggagcaatttacgtctgttccgcgacggcgat
ggctttgcatggattgaacggcgcagcgtgcgtgaaccgcagctgactgaactgaaaaaa
tatgcggtgttctctaaagtgaccatcgcgccagacgacgagcgtgtgctgcttggtgtt
gccggttttcaggcgcgcaccgcgttggcaaatctctttagtgaactaccttcgagagaa
aaacaggtagtcaaagaaggcgcgaccacgttgctatggtttgaacacccggcagaacgt
ttcctgatcgtaaccgatgaagctactgccaatatgctgaccgataaactgcgcggtgaa
gcggaactgaacaatagccaacagtggctggcattaaacattgaagcgggttttccggtg
attgatgccgccaacagcgggcagtttatcccccaggcgaccaacctccaggcgctgggc
ggcatcagctttaagaaaggctgctataccggacaagagatggtggcgcgagcaaaattc
cgtggtgccaacaaacgcgcgctctggttgctgacgggtagcgccagccgactgccggaa
gctggtgaagacttagagctgaaaatgggcgagaactggcgtcgtaccggtacggtgctg
gctgcggtcaaactggaagatggtcaggttgtggtgcaggttgtcatgaataacgatatg
gaaccggacagcatcttccgcgtgcgtgacgatgcgaatacattgcgtattgagccactg
ccatattcgctggaagagtaa

DBGET integrated database retrieval system