KEGG   Escherichia coli NA114 (UPEC): ECNA114_2942
Entry
ECNA114_2942      CDS       T01998                                 

Gene name
ygfA
Definition
(GenBank) hypothetical protein
  KO
K11068  hemolysin III
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ena02042]
    ECNA114_2942 (ygfA)
Bacterial toxins [BR:ena02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   ECNA114_2942 (ygfA)
SSDB
Motif
Pfam: HlyIII
Other DBs
NCBI-ProteinID: AEG37779
Position
complement(3027670..3028329)
AA seq 219 aa
MVQKPLIKQGYSLAEEIANSVSHGIGLVFGIVGLVLLLVQAVDLNASATAITSYSLYGGS
MILLFLASTLYHAIPHQRAKMWLKKFDHCAIYLLIAGTYTPFLLVGLDSPLARGLMIVIW
SLALLGILFKLTIAHRFKILSLVTYLAMGWLSLVVIYEMAVKLAAGSVTLLAVGGVVYSL
GVIFYVCKRIPYNHAIWHGFVLGGSVCHFLAIYLYIGQV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggttcagaagcccctcattaagcagggatattcgctggcagaggaaattgccaacagc
gtcagtcacggcattgggctggtgtttggtatcgttgggctggtgttgctactggttcag
gcggtggatctcaatgccagcgccacggcgataaccagttacagcctctatggcggcagt
atgatcctgctgttcctcgcttcgacgctctatcacgccattcctcatcaacgggcaaaa
atgtggctgaagaaatttgaccactgcgctatttatctgttgattgccggaacctacacg
ccgtttttgctggtggggctggattctccgttagcgcgcgggttgatgattgttatctgg
agcctggcattgctgggtattctgtttaaactgaccatcgcgcaccgattcaaaatttta
tctctggtgacctatctggcgatgggctggctgtcgctggtggtaatttatgaaatggca
gttaagctcgcggcgggcagcgttaccttactggcggtaggcggtgtggtttattcgctc
ggggtgattttctacgtctgcaagcgcattccatacaatcatgccatctggcacggcttt
gtgctcggcggtagtgtgtgccactttctggcgatctatttgtatattgggcaggtgtaa

DBGET integrated database retrieval system