KEGG   Escherichia coli NA114 (UPEC): ECNA114_2943
Entry
ECNA114_2943      CDS       T01998                                 

Gene name
ygfB1
Definition
(GenBank) hypothetical protein
  KO
K09900  uncharacterized protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECNA114_2943 (ygfB1)
SSDB
Motif
Pfam: ASCH DUF3850 DUF3022 Saccharop_dh_N
Other DBs
NCBI-ProteinID: AEG37780
Structure
PDB: 
1TE7

Position
complement(3028493..3028804)
AA seq 103 aa
MQPNDITFFQRFQDDILAGRKTITIRDESESHFKTGDVLRVGRFEDDGYFCTIEVTATST
VTLDTLTEKHAEQENMTLTELKKVIADIYPDQTQFYVIEFKCL
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcagccaaacgacatcactttttttcaacgtttccaggatgacattctggctgggcgt
aaaaccatcaccatccgcgacgagtctgaatcgcacttcaaaacgggtgatgtgcttcgt
gtcggacgttttgaagatgacggttatttttgcacgattgaagtcaccgcaacctcaacc
gtaacgctggatacgctgacggaaaaacatgcagagcaggaaaatatgaccctgactgaa
ctgaaaaaggtcattgccgacatctatcccgaccagacacagttttatgtgattgaattt
aaatgtctttaa

DBGET integrated database retrieval system