KEGG   Escherichia coli NA114 (UPEC): ECNA114_2944
Entry
ECNA114_2944      CDS       T01998                                 

Gene name
bglA
Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_2944 (bglA)
   00500 Starch and sucrose metabolism
    ECNA114_2944 (bglA)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ECNA114_2944 (bglA)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase
Other DBs
NCBI-ProteinID: AEG37781
Structure
PDB: 
2XHY

Position
3028843..3030282
AA seq 479 aa
MIVKKLTLPKDFLWGGAVAAHQVEGGWNKGGKGPSICDVLTGGAHGVPREITKEVVPGKY
YPNHEAVDFYGHYKEDIKLFAEMGFKCFRTSIAWTRIFPKGDEAQPNEEGLKFYDDMIDE
LLKYNIEPVITLSHFEMPLHLVQQYGSWTNRKVVDFFVRFAEVVFERYKHKVKYWMTFNE
INNQRNWRAPLFGYCCSGVVYTEHENPEETMYQVLHHQFVASALAVKAAHRINPEMKVGC
MLAMVPLYPYSCNPDDVMFAQKSMRERYVFTDVQLRGYYPSYVLNEWERRGFNIKMEDGD
LDVLREGTCDYLGFSYYMTNAVKAEGGTGDAISGFEGSVPNPYVKASDWGWQIDPVGLRY
ALCELYERYQKPLFIVENGFGAYDKVEDDGSINDDYRIDYLRAHIEEMKKAVTYDGVDLM
GYTPWGCIDCVSFTTGQYSKRYGFIYVNKHDDGTGDMSRSRKKSFNWYKEVIASNGENL
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgatagtgaaaaaactcaccttaccgaaagatttcttatggggcggcgcagttgccgct
catcaggtcgaaggcggctggaacaaaggcggcaaagggccgagcatttgtgacgttctg
accggtggcgcacacggcgtgccgcgcgaaatcaccaaagaagttgtgcctggcaaatac
tatccaaaccatgaagccgttgatttttatggtcactacaaggaggacatcaagctattt
gccgaaatgggcttcaaatgttttcgtacttccatcgcctggacgcgcatttttccaaaa
ggcgatgaagctcagccaaacgaagaagggctgaagttctacgatgatatgatcgatgaa
ctgctgaaatacaacatcgaaccggtgatcaccctctcccactttgaaatgccgctgcat
ctggtgcagcaatatggtagctggaccaaccgtaaagtggttgatttctttgtccgtttc
gcggaagtggtattcgaacgctataagcacaaagtcaaatactggatgaccttcaacgaa
attaacaaccagcgtaactggcgtgcaccgctgttcggttactgctgctccggcgtggtg
tataccgaacatgaaaacccggaagagaccatgtatcaggtgctgcatcaccagtttgtc
gccagcgccctggcggtgaaagccgcgcatcgcatcaacccggagatgaaagtcggttgt
atgctggcgatggtgccgctctatccctactcctgtaacccggacgatgtgatgtttgcc
cagaagtcgatgcgcgaacgttacgtctttaccgatgtgcagttgcgtggctattacccg
tcctatgtgttgaacgagtgggaacgccgcggatttaacatcaaaatggaagacggcgat
ctggatgtactgcgcgaaggcacctgcgattatctcggcttcagctattacatgaccaac
gcggtgaaggccgaaggcggcaccggcgatgcgatctctggttttgaaggcagcgtaccg
aacccgtatgttaaagcgtctgactggggctggcagattgatccggttggtctgcgttac
gcgctttgcgagctgtatgagcgttaccagaagccgctgtttattgtcgaaaacggtttt
ggcgcttacgacaaagtggaagatgatggcagcatcaatgacgattaccgcattgactac
ctgcgcgcccatattgaagagatgaaaaaagcggtgacttacgatggcgtggatctgatg
ggctacacaccgtggggctgcatcgactgcgtgtcgttcactaccgggcagtacagcaaa
cgctacggctttatctatgtgaataaacatgacgacggtactggcgatatgtcgcgttca
cgtaagaagagctttaactggtacaaagaggtgattgccagcaacggcgagaatttgtaa

DBGET integrated database retrieval system