KEGG   Escherichia coli NA114 (UPEC): ECNA114_2945
Entry
ECNA114_2945      CDS       T01998                                 

Gene name
gcvP
Definition
(GenBank) Glycine dehydrogenase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00260  Glycine, serine and threonine metabolism
ena00630  Glyoxylate and dicarboxylate metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECNA114_2945 (gcvP)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNA114_2945 (gcvP)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     ECNA114_2945 (gcvP)
SSDB
Motif
Pfam: GDC-P Beta_elim_lyase Aminotran_5
Other DBs
NCBI-ProteinID: AEG37782
Position
complement(3030448..3033321)
AA seq 957 aa
MTQTLSQLENSGAFIERHIGPDAAQQQEMLNAVGAQSLNALTGQIVPKDIQLATPPQVGA
PATEYAALAELKAIASRNKRFTSYIGMGYTAVQLPPVILRNMLENPGWYTAYTPYQPEVS
QGRLEALLNFQQVTLDLTGLDMASASLLDEATAAAEAMAMAKRVSKLKNANRFFVASDVH
PQTLDVVRTRAETFGFEVIVDDAQKVLDHQDVFGALLQQVGTTGEIHDYTALISELKSRK
IVVSVAADIMALVLLTAPGKQGADIVFGSAQRFGVPMGYGGPHAAFFAAKDEYKRSMPGR
IIGVSKDAAGNTALRMAMQTREQHIRREKANSNICTSQVLLANIASLYAVYHGPVGLKRI
ANRIHRLTDILAAGLQQKGLKLRHAHYFDTLCVEVADKAGVLARAEAAEINLRSDILNAV
GITLDETTTRENVMQLFSVLLGDNHGLDIDTLDKDVAHDSRSIQAAMLRDDEILTHPVFN
RYHSETEMMRYMHSLERKDLALNQAMIPLGSCTMKLNAAAEMIPITWPEFAELHPFCPPE
QAEGYQQMIAQLAEWLVKLTGYDAVCMQPNSGAQGEYAGLLAIRHYHESRNEGHRDICLI
PASAHGTNPASAHMAGMQVVVVACDKNGNIDLTDLRAKAEQAGDNLSCIMVTYPSTHGVY
EETIREVCEVVHQFGGQVYLDGANMNAQVGITSPGFIGADVSHLNLHKTFCIPHGGGGPG
MGPIGVKAHLAPFVPGHSVVQIEGMLIRQGAVSAAPFGSASILPISWMYIRMMGAEGLKK
ASQVAILNANYIASRLQDAFPVLYTGRDGRVAHECILDIRPLKEETGISELDIAKRLIDY
GFHAPTMSFPVAGTLMVEPTESESKVELDRFIDAMLAIRAEIDQVKAGVWPLEDNPLVNA
PHIQSELVAEWAHPYSREVAVFPAGVADKYWPTVKRLDDVYGDRNLFCSCVPISEYQ
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgacacagacgttaagccagcttgaaaacagcggcgcttttattgaacgccatatcgga
ccggacgccgcgcaacagcaagaaatgctgaatgccgttggcgcacaatcgttaaacgcg
ctgaccggccagattgtgccgaaagatattcagcttgcgactccgccgcaggttggcgca
ccggcgaccgaatacgccgcactggcagaactcaaggctattgccagtcgcaataaacgc
ttcacgtcttacatcggcatgggttacaccgccgtgcagctaccgccggttatcctgcgt
aacatgctggaaaatccgggctggtataccgcgtatactccgtatcaacctgaagtctcc
cagggccgccttgaagcactgctcaacttccagcaggtaacgctggatttaaccgggctg
gatatggcctctgcttctcttcttgacgaagccaccgctgccgccgaagcaatggcgatg
gcgaaacgcgtcagcaaactgaaaaatgccaaccgcttctttgttgcttctgacgttcat
ccgcaaacgctggatgtggtccgtactcgtgccgaaacctttggttttgaagtgattgtc
gatgatgcgcaaaaagtgctcgaccatcaggacgtcttcggcgcgctgttacagcaggtc
ggcactactggtgaaattcacgactacactgcgcttattagcgaactgaaatcacgcaaa
attgtggtcagcgttgccgccgatattatggcgctggtgctgttaactgcgccaggtaaa
cagggcgcggatattgtttttggttcggcgcaacgctttggcgtaccgatgggctacggt
ggcccacacgcggcattctttgcggcgaaagacgaatacaaacgctcaatgccgggccgt
attatcggtgtatcgaaagatgcagctggcaacaccgctctgcgcatggcgatgcagact
cgtgagcaacatattcgtcgtgaaaaagcgaactccaacatttgtacatcccaggtcttg
ctggcaaacattgccagtctgtatgccgtttaccacggtccggttggcctgaaacgtatc
gctaaccgcatccaccgtctgaccgatatcctggcggcgggcctgcaacaaaaaggtctg
aagctgcgccatgcgcactatttcgatactttgtgtgtggaagtggccgacaaagcgggc
gtgctggcgcgtgccgaagcggctgaaatcaacctgcgtagcgatattctgaacgcggtt
gggatcacccttgatgaaaccactacgcgcgaaaacgtgatgcagcttttcagcgtgctg
ttgggcgataaccacgggctggacatcgacacactggacaaagacgtggctcacgacagt
cgctctattcaggctgcgatgctgcgcgacgacgaaatcctcacccatccggtgtttaat
cgctaccacagcgaaaccgaaatgatgcgctatatgcactcgctggagcgtaaagatctg
gcgctgaatcaggcgatgatcccgctgggttcctgcaccatgaaactgaacgccgccgcc
gagatgatcccgatcacctggccggaatttgccgaactgcacccgttctgcccgccggaa
caggctgaaggttatcagcagatgatcgcgcagctggctgagtggctggtgaaactgacc
ggttacgacgccgtttgtatgcagccgaactctggcgcacagggcgaatacgcgggcctg
ctggcgattcgtcattatcatgaaagccgcaacgaagggcatcgcgatatctgcctgatc
ccggcttctgcgcacggcactaacccggcttccgcgcatatggcaggaatgcaggtggtg
gttgtggcgtgtgataaaaacggcaacatcgatctgactgatctgcgcgcgaaagccgaa
caggcgggcgataacctctcctgtatcatggtgacctatccttccacccacggcgtgtat
gaagaaacgatccgtgaagtgtgtgaagtcgtgcatcagttcggcggtcaggtttacctt
gatggcgcgaacatgaacgctcaggttggcatcacctcgccgggctttattggtgcggac
gtttcccaccttaacctgcataaaactttctgcattccgcatggcggtggtggtccgggt
atgggaccgatcggtgtgaaagcgcatctggctccgtttgtaccgggtcatagcgtggtg
caaatcgaaggcatgttaatccgtcagggcgcggtttctgcggcaccgttcggtagtgcc
tctatcctgccaatcagctggatgtacatccgcatgatgggcgcagaagggctgaaaaaa
gcaagccaggtggcaattcttaacgccaactatattgccagccgtctgcaggatgccttc
ccggtgctgtataccggtcgcgacggtcgcgtggcgcacgaatgtattctcgatattcgc
ccgctgaaagaagaaaccggcatcagcgagctggatattgccaagcgcctgatcgactac
ggtttccacgcgccgaccatgtcgttcccggtggcgggtacgctgatggttgaaccgact
gaatctgaaagcaaagtggaactggatcgctttatcgatgcgatgctggctatccgcgca
gaaattgaccaggtgaaagccggtgtctggccgctggaagataacccgctggtgaacgcg
ccgcacattcagagcgaactggtcgccgagtgggcgcatccgtacagtcgtgaagttgca
gtattcccggcaggtgtggcagacaaatactggccgaccgtgaaacgtctggatgatgtt
tacggcgaccgtaacctgttctgctcctgcgtaccgattagcgaataccagtaa

DBGET integrated database retrieval system