KEGG   Escherichia coli NA114 (UPEC): ECNA114_2946
Entry
ECNA114_2946      CDS       T01998                                 

Gene name
gcvH
Definition
(GenBank) Glycine cleavage system H protein
  KO
K02437  glycine cleavage system H protein
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00260  Glycine, serine and threonine metabolism
ena00630  Glyoxylate and dicarboxylate metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECNA114_2946 (gcvH)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNA114_2946 (gcvH)
SSDB
Motif
Pfam: GCV_H RnfC_N Biotin_lipoyl
Other DBs
NCBI-ProteinID: AEG37783
Structure
PDB: 

Position
complement(3033440..3033829)
AA seq 129 aa
MSNVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAV
AESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDAT
AYEALLEDE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgagcaacgtaccagcagaactgaaatacagcaaagaacacgaatggttgcgtaaagaa
gccgacggcacttacaccgttggcatcaccgaacacgctcaggagctgttaggcgatatg
gtgtttgttgacctgccggaagtgggcgcaacggttagcgcgggcgatgactgcgcggtt
gccgaatcggtaaaagcggcgtcagatatttatgcgccagtaagcggtgaaatcgtggcg
gtaaacgatgcactgagcgattctccggaactggtcaacagcgaaccgtatgcaggcggc
tggattttcaaaatcaaagccagcgatgaaagcgaactggaatcactgctggatgcaacc
gcatacgaagcattgttagaagacgagtaa

DBGET integrated database retrieval system