KEGG   Escherichia coli NA114 (UPEC): ECNA114_2947
Entry
ECNA114_2947      CDS       T01998                                 

Definition
(GenBank) Aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00260  Glycine, serine and threonine metabolism
ena00630  Glyoxylate and dicarboxylate metabolism
ena00670  One carbon pool by folate
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECNA114_2947
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNA114_2947
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    ECNA114_2947
Enzymes [BR:ena01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     ECNA114_2947
SSDB
Motif
Pfam: GCV_T GCV_T_C POPLD
Other DBs
NCBI-ProteinID: AEG37784
Structure
PDB: 
1VLO 3A8K 3A8J 3A8I

Position
complement(3033853..3034947)
AA seq 364 aa
MAQQTPLYEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRTDAGMFDVSHMTIVDLRGS
RTREFLRYLLANDVAKLTKSGKALYSGMLNASGGVIDDLIVYYFTEDFFRLVVNSATREK
DLSWITQHAEPFGIEITVRDDLSMIAVQGPNAQAKAATLFNDAQRQAVEGMKPFFGVQAG
DLFIATTGYTGEAGYEIALPNEKAADFWRALVEAGVKPCGLGARDTLRLEAGMNLYSQEM
DETISPLAANMGWTIAWEPADRDFIGREALEAQREHGTEKLVGLVMTEKGVLRNELPVRF
TDAQGNQHEGIITSGTFSPTLGYSIALARVPEGIGETAIVQIRNREMPVKVTKPVFVRNG
KAVA
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggcacaacagactcctttgtacgaacaacacacgctttgcggcgctcgcatggtggat
ttccacggctggatgatgccgctgcattacggttcgcaaatcgacgaacatcatgcggta
cgtaccgatgccggaatgtttgatgtgtcacatatgaccatcgtcgatcttcgcggcagc
cgcacccgggagtttctacgttatctgctggcgaacgatgtggcgaagctcaccaaaagc
ggcaaagccctttactcggggatgttgaatgcctctggcggtgtgatagatgatctcatc
gtctactactttactgaagatttcttccgcctcgttgttaactccgccacccgcgaaaaa
gacctctcctggattacccaacacgctgaacctttcggcatcgaaattactgttcgtgat
gacctttccatgatcgccgtacaagggccgaatgcgcaggcaaaagctgccacactgttt
aatgacgcccagcgtcaggcggtggaagggatgaaaccgttctttggcgtgcaggcgggc
gatctgtttattgccaccaccggttacaccggtgaagcgggctacgaaattgcgctgccc
aatgaaaaagcggccgatttctggcgcgcgctggtggaagctggcgttaagccatgtggc
ctgggcgcgcgtgacacgctgcgtctggaagcgggcatgaatttgtatagccaggagatg
gacgaaactatttctcctttagccgccaatatgggctggactatcgcctgggaaccggca
gatcgtgactttatcggtcgtgaagctctggaagcgcagcgtgaacatggcacagaaaaa
ctggttggtctggtgatgaccgaaaaaggcgtgctgcgtaatgaactgccggtacgtttt
actgatgcgcagggcaaccagcatgaaggcattatcaccagcggtactttctccccaacg
ctgggttatagcattgcgctggcgcgcgtgccggaaggtattggtgaaacggcgattgtg
caaattcgcaaccgtgaaatgccggttaaagtgacgaaacctgtttttgtgcgtaacggc
aaagccgtcgcgtga

DBGET integrated database retrieval system