KEGG   Escherichia coli NA114 (UPEC): ECNA114_2949
Entry
ECNA114_2949      CDS       T01998                                 

Gene name
visC
Definition
(GenBank) VisC protein
  KO
K18800  2-polyprenylphenol 6-hydroxylase [EC:1.14.13.240]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00130  Ubiquinone and other terpenoid-quinone biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
Module
ena_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECNA114_2949 (visC)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.240  2-polyprenylphenol 6-hydroxylase
     ECNA114_2949 (visC)
SSDB
Motif
Pfam: FAD_binding_3 Lycopene_cycl DAO Trp_halogenase SE Pyr_redox Pyr_redox_2 Thi4 NAD_binding_8 FAD_binding_2 Pyr_redox_3 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: AEG37786
Structure
PDB: 
4K22

Position
complement(3035395..3036597)
AA seq 400 aa
MQSVDVAIVGGGMVGLAVACGLQGIGLRVAVLEQRVPEPLAADAPPQLRVSAINAASEKL
LTRLGVWQDILSRRACCYHGMEVWDKDSFGHISFDDQSMGYSHLGHIVENSVIHYALWNK
ALQSSDITLLAPAELQQVAWGENETFLTLKDGSMLTARLVIGADGANSWLRNKADIPLTF
WDYQHHALVATIRTEEPHDAVARQVFHGEGILAFLPLSDPHLCSIVWSLSPEEAQRMQQA
GEDEFNRALNIAFDNRLGLCKVESERLVFPLTGRYARQFAAHRLALVGDAAHTIHPLAGQ
GVNLGFMDAAELIAELKRLHRQGKDIGQYIYLRRYERSRKHSAALMLAGMQGFRDLFSGA
NPAKKLLRDIGLKLADTLPGVKPQLIRQAMGLNDLPEWLR
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgcaaagtgttgatgtagccattgttggcggcggcatggtcgggctggcggttgcctgc
ggcttacagggtatcggcttacgcgttgccgtactggagcagcgcgtaccggaacctctg
gcggcggatgcaccaccacaactgcgcgtttcggctatcaatgccgccagcgaaaaatta
ctcacccgtcttggcgtctggcaggacattctctctcgtagggcctgttgctatcacggc
atggaagtgtgggacaaagacagctttggtcacatctcgtttgacgatcaaagcatgggc
tatagccatcttgggcatatcgttgaaaactcagtgattcactacgcgctgtggaacaaa
gcgctgcagtcgtcagatatcactctgttggcccccgcagaattacagcaggtcgcctgg
ggtgaaaatgaaaccttcctgacgttgaaagatggcagcatgttaacggcgcgtctggtg
attggcgcggacggcgctaattcctggttgcgcaacaaagccgatattccgctgactttc
tgggattatcagcatcacgcgctggtggcgaccattcgcacggaagaaccgcatgatgcg
gtggcgcgacaggtttttcatggcgaaggcattctggcctttttgccgcttagcgatccg
catctttgctcgattgtctggtcactgtcgccagaggaagcgcagcggatgcagcaggca
ggcgaagacgaatttaatcgcgcgttaaatatcgcttttgataatcgcctgggcttatgc
aaggttgaaagtgagcgcctggtgttcccgctaacggggcgttatgcgcgccagtttgcc
gcgcaccgtctggcgctggtgggcgacgccgcgcataccattcacccgttggcggggcag
ggggtaaatctcggctttatggatgctgcagagctgattgctgaactgaaacggttgcat
cgtcagggtaaagacatcgggcagtacatttacctgcgtcgctatgagcgtagccgcaag
cacagcgcggcgctgatgctggctggtatgcagggattccgcgatctgttttccggggct
aatccggcgaaaaaattgctgcgtgatattggtctgaaactggctgatacgcttcctggc
gttaagccacaacttattcgccaggcaatgggattaaacgatttgcctgaatggctgcgt
taa

DBGET integrated database retrieval system