KEGG   Escherichia coli NA114 (UPEC): ECNA114_2950
Entry
ECNA114_2950      CDS       T01998                                 

Gene name
ubiH
Definition
(GenBank) 2-octaprenyl-6-methoxyphenol hydroxylase
  KO
K03185  2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00130  Ubiquinone and other terpenoid-quinone biosynthesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
Module
ena_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    ECNA114_2950 (ubiH)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.-  
     ECNA114_2950 (ubiH)
SSDB
Motif
Pfam: FAD_binding_3 Trp_halogenase Lycopene_cycl Pyr_redox_2 NAD_binding_9 SE NAD_binding_8 DAO DUF4453 DUF2924 FAD_binding_2 GIDA AAA_19
Other DBs
NCBI-ProteinID: AEG37787
Position
complement(3036620..3037798)
AA seq 392 aa
MSVIIVGGGMAGATLALAISRLSHGALPVHLIEATAPESHAHPGFDGRAIALAAGTCQQL
ARIGVWQSLADCATAITTVHVSDRGHAGFVTLAAEDYQLAALGQVVELHNVGQRLFALLR
KAPGVTLHCPDRVANVARTQSHVEVTLESGETLTGRVLVAADGTHSALATACGVDWQQEP
YEQLAVIANVATSVAHEGRAFERFTQYGPLAMLPMSDGRCSLVWCHPLERREEVLSWSDE
KFCRELQSAFGWRLGQITHAGKRSAYPLALTRAAKPITHRTVLVGNAAQTLHPIAGQGFN
LGMRDVMSLAETLTQAQERREDMGDYGVLCRYQQRRQRDREATIGVTDSLVHLFANRWTP
LVVGRNIGLMTMELFTPARDVLAQRTLGWVAR
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgagcgtaatcatcgtcggtggcggcatggcgggcgcgacgctggcgctggctatttcc
cggttaagtcacggggcgctgccagtacatttgattgaagcgaccgcgccagagtcacat
gcgcatccgggctttgatggacgagctattgcgctggcggcgggtacctgtcagcaactg
gcgcgcatcggcgtctggcaatctctggctgattgcgcaactgccatcaccaccgtgcat
gttagcgatcgtggtcacgctggatttgtcaccctcgccgcagaagattaccaactggcg
gcgctggggcaggttgtcgaattgcacaatgtcgggcaacggctgtttgcattgctgcgc
aaagcacctggcgtaacgctgcattgccctgatcgcgtggctaacgttgcccgtactcag
agccacgttgaagtgacgctggagagtggcgagacgctgacgggccgcgtgctggtagcc
gctgatggcacccattcagcgttagccaccgcgtgcggtgttgactggcagcaggagcct
tacgaacaactggctgtgattgccaacgttgcgacttccgttgcgcatgaagggcgcgct
tttgaacgctttacacaatatggcccgctggcgatgttgccgatgtctgacggacgctgt
tcgctggtctggtgtcatccactggaacggcgcgaagaggtgctgtcgtggagcgacgag
aagttctgccgtgaactccagtcggcctttggctggcgactggggcaaattacccacgcc
ggaaaacgtagtgcttatccgctggcgttaacccgcgccgccaaacctattacccatcgt
accgtgctggtggggaatgcggcgcaaactctgcatcccatcgccgggcaaggatttaac
ctcggtatgcgtgatgtgatgagtcttgcagaaaccctgactcaggcgcaggaacgcaga
gaagacatgggtgattacggcgtattgtgccgttatcagcagcgtcgacagcgcgatcgc
gaagcaaccatcggcgtcacggacagccttgtacatctttttgccaaccgttggacgccg
ctggttgtcgggcgcaacatcgggctgatgacgatggaattatttaccccggcacgcgat
gtgctggcgcagcgcactcttggttgggtggcgcgttga

DBGET integrated database retrieval system