KEGG   Escherichia coli NA114 (UPEC): ECNA114_2951
Entry
ECNA114_2951      CDS       T01998                                 

Gene name
pepP
Definition
(GenBank) Xaa-Pro aminopeptidase
  KO
K01262  Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ena01002]
    ECNA114_2951 (pepP)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     ECNA114_2951 (pepP)
Peptidases and inhibitors [BR:ena01002]
 Metallo peptidases
  Family M24
   ECNA114_2951 (pepP)
SSDB
Motif
Pfam: Peptidase_M24 AMP_N
Other DBs
NCBI-ProteinID: AEG37788
Structure
PDB: 

Position
complement(3037795..3039120)
AA seq 441 aa
MSDISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPE
AVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQ
LLNGLDVVYHAQGEYAYADEIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPE
EIAVLRRAGEITALAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENG
CILHYTENECELRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLET
SLRLYRPGTSIQEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLD
VHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENL
TASVVKKPEEIEALMAAARKQ
NT seq 1326 nt   +upstreamnt  +downstreamnt
atgagtgatatatcccggcaagaatttcagcgtcgccgtcaggccctggtagagcaaatg
caacccggcagcgccgcgctgatttttgctgcaccagaagtaacacgtagcgccgacagc
gaatacccctatcgtcagaacagtgacttctggtacttcaccggctttaacgaaccggaa
gcggtgctggtgctgattaaaagcgatgacactcataaccacagcgttttgtttaaccgc
gttcgcgacctgacggcagagatctggtttggtcgtcgcttaggccaggatgccgcgcca
gagaaactgggcgttgaccgcgcactggcattcagcgaaatcaatcaacaactttatcaa
ctacttaatggtctggatgtggtttaccacgcccagggcgaatatgcatatgctgatgaa
atcgtgaacagcgcgcttgagaaactgcgtaaaggttcgcggcaaaatctcaccgcaccg
gcaacgatgatcgactggcgtcctgttgttcatgaaatgcgcctgttcaaatcaccagaa
gagattgccgtacttcgccgcgcgggtgaaatcaccgcactggcgcatacacgggcgatg
gaaaaatgccgtccggggatgttcgagtaccatctggaaggcgaaattcaccacgaattt
aaccgccacggtgcgcgttacccttcctataacaccattgttggcagcggtgaaaacggc
tgcattttgcattacaccgaaaacgagtgtgaactgcgtgacggtgacctggtgttgatt
gacgcgggttgtgaatacaaaggttacgctggcgacattacccgcaccttcccggtcaac
ggcaaattcactcaggctcagcgtgaaatctatgacattgtgctggagtctcttgaaacc
agcctgcgcctgtatcgtccgggaacttccattcaggaagtcactggtgaagtggtgcgc
atcatggttagcggtctggtaaaactcggcatcctgaaaggtgatgttgatgaactgatc
gctcagaacgcccatcgtcctttctttatgcatggccttagccactggttaggactggat
gttcatgacgttggtgtttatggtcaggatcgctcgcgtattctggaaccgggtatggta
ctgaccgtagaaccaggactgtatattgcgccggatgcagaagtgccagaacagtatcgc
ggtatcggcattcgtattgaagacgatattgtgattaccgaaaccggtaatgaaaacctc
accgccagcgtggtgaaaaagccggaagaaatcgaagcgttgatggcagctgcgagaaag
caatga

DBGET integrated database retrieval system