KEGG   Escherichia coli NA114 (UPEC): ECNA114_2952
Entry
ECNA114_2952      CDS       T01998                                 

Gene name
ygfB2
Definition
(GenBank) hypothetical protein
  KO
K09895  uncharacterized protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECNA114_2952 (ygfB2)
SSDB
Motif
Pfam: UPF0149
Other DBs
NCBI-ProteinID: AEG37789
Position
complement(3039146..3039706)
AA seq 186 aa
MPGYNEMNQYLNQQGTGLTPAEMHGLISGMICGGNDDSSWLPLLHDLTNEGMAFGHELAQ
ALRKMHSATSDALQDDGFLFQLYLPDGDDVSVFDRADALAGWVNHFLLGLGVTQPKLDKV
TGETGEAIDDLRNIAQLGYDEDEDQEELEMSLEEIIEYVRVAALLCHDTFTHPQPTAPEV
QKPTLH
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcctggttacaacgaaatgaaccagtatctgaaccaacaagggacgggtctgacccct
gctgagatgcatggtttaatcagtgggatgatatgtggcggtaacgatgacagctcatgg
ctgccgctacttcacgacctgacgaacgaaggcatggctttcggtcatgagctggcacag
gcactgcgcaaaatgcactctgccaccagcgatgccctgcaggatgacggcttccttttt
cagctttatctacctgatggcgatgatgtcagcgttttcgatcgggctgatgcgctggct
ggttgggtcaatcacttcctgcttggtcttggcgttacgcaaccgaagctggacaaagtg
accggcgaaaccggtgaagccatcgacgatctgcgtaacatcgcgcagttgggttacgac
gaagacgaagatcaggaagagcttgaaatgtcgcttgaagagatcatcgagtacgtccgt
gttgccgcgctgttatgccacgacacctttactcatccgcaaccgaccgcgccagaagta
caaaaaccgactctacactaa

DBGET integrated database retrieval system