KEGG   Escherichia coli NA114 (UPEC): ECNA114_2953
Entry
ECNA114_2953      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K09888  cell division protein ZapA
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ena03036]
    ECNA114_2953
Chromosome and associated proteins [BR:ena03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    ECNA114_2953
SSDB
Motif
Pfam: ZapA DUF3482 Bac_rhamnosid6H PEP-utilisers_N YtxH
Other DBs
NCBI-ProteinID: AEG37790
Structure
PDB: 
4P1M

Position
3039892..3040221
AA seq 109 aa
MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALN
ISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKTNQNFE
NT seq 330 nt   +upstreamnt  +downstreamnt
atgtctgcacaacccgtcgatatccaaatttttggccgttcactgcgtgtgaactgcccg
cctgaccaaagggatgcgttgaatcaggcagcggacgatctgaaccaacggttgcaagat
ctgaaagaacgcactagagtcacaaatactgaacagttggtcttcattgccgcactgaat
atcagctatgagttagcgcaagaaaaagcgaagactcgtgactacgcggcaagtatggaa
cagcgtattcggatgctgcagcagaccatagaacaagcgttacttgaacaaggtcgcatc
accgaaaaaactaaccaaaactttgaatga

DBGET integrated database retrieval system