KEGG   Escherichia coli NA114 (UPEC): ECNA114_2955
Entry
ECNA114_2955      CDS       T01998                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00260  Glycine, serine and threonine metabolism
ena00270  Cysteine and methionine metabolism
ena00680  Methane metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ECNA114_2955 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECNA114_2955 (serA)
   00270 Cysteine and methionine metabolism
    ECNA114_2955 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ena04147]
    ECNA114_2955 (serA)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ECNA114_2955 (serA)
    1.1.1.399  2-oxoglutarate reductase
     ECNA114_2955 (serA)
Exosome [BR:ena04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNA114_2955 (serA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 ACT_4 3HCDH_N AlaDh_PNT_C Oxidored_nitro
Other DBs
NCBI-ProteinID: AEG37792
Structure
PDB: 

Position
complement(3041458..3042690)
AA seq 410 aa
MAKVSLEKDKIKFLLVEGVHQKALESLRAAGYTNIEFHKGALDDEQLKESIRDAHFIGLR
SRTHLTEDVINAAEKLVAIGCFCIGTNQVDLDAAAKRGIPVFNAPFSNTRSVAELVIGEL
LLLLRGVPEANAKAHRGVWNKLAAGSFEARGKKLGIIGYGHIGTQLGILAESLGMYVYFY
DIENKLPLGNATQVQHLSDLLNMSDVVSLHVPENPSTKNMMGAKEISLMKPGSLLINASR
GTVVDIPALCDALASKHLAGAAIDVFPTEPATNSDPFTSPLCEFDNVLLTPHIGGSTQEA
QENIGLEVAGKLIKYSDNGSTLSAVNFPEVSLPLHGGRRLMHIHENRPGVLTALNKIFAE
QGVNIAAQYLQTSAQMGYVVIDIEADEDVAEKALQAMKAIPGTIRARLLY
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggcaaaggtatcgctggagaaagacaagattaagtttctgctggtagaaggcgtgcac
caaaaggcgctggaaagccttcgtgcagctggttacaccaacatcgaatttcacaaaggc
gcgctggatgatgaacaattaaaagaatccatccgcgatgcccacttcatcggcctgcga
tcccgtacccatctgactgaagacgtgatcaacgccgcagaaaaactggtcgctattggc
tgtttctgtatcggaacaaaccaggttgatctggatgcggcggcaaagcgcgggatcccg
gtatttaacgcaccgttctcaaatacgcgctctgttgcggagctggtgattggcgaactg
ctgctgctattgcgcggcgtgccggaagccaatgctaaagcgcatcgtggcgtgtggaac
aaactggcggcgggttcttttgaagcgcgcggcaaaaagctgggtatcatcggctacggt
catattggtacgcaattgggcattctggctgaatcgctgggaatgtatgtttacttttat
gatattgaaaacaaactgccgctgggcaacgccactcaggtacagcatctttctgacctg
ctgaatatgagcgatgtggtgagtctgcatgtaccagagaatccgtcaaccaaaaatatg
atgggcgcgaaagagatttcgctaatgaaacccggctcgctgctgattaatgcttcgcgc
ggtactgtggtggatattccagcgctgtgtgacgcgctggcgagcaaacatctggcgggg
gcggcaatcgacgtattcccgacggaaccggcgaccaatagcgatccatttacctctccg
ctgtgtgaattcgacaatgtccttctgacgccacacattggcggttcgactcaggaagcg
caggagaatattggcctggaagttgcgggtaaattgatcaagtattctgacaatggttca
acgctctctgcggtgaacttcccggaagtctcgctgccactgcacggtggtcgtcgtctg
atgcacatccacgaaaaccgtccgggtgtgctgactgcgctcaacaaaatttttgccgag
cagggcgtcaacatcgccgcgcaatatctgcaaacttccgcccagatgggttatgtagtt
attgatattgaagccgacgaagacgttgccgaaaaagcgctgcaggcaatgaaagctatt
ccgggtaccattcgcgcccgtctgctatactaa

DBGET integrated database retrieval system