KEGG   Escherichia coli NA114 (UPEC): ECNA114_2956
Entry
ECNA114_2956      CDS       T01998                                 

Gene name
rpiA
Definition
(GenBank) Ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00030  Pentose phosphate pathway
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ena_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECNA114_2956 (rpiA)
Enzymes [BR:ena01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     ECNA114_2956 (rpiA)
SSDB
Motif
Pfam: Rib_5-P_isom_A DeoRC
Other DBs
NCBI-ProteinID: AEG37793
Structure
PDB: 
1O8B 1KS2 1LKZ

Position
complement(3042946..3043605)
AA seq 219 aa
MTQDELKKAVGWAALQYVQPGTIVGVGTGSTAAHFIDALGTMKGQIEGAVSSSDASTEKL
KSLGIHVFDLNEVDSLGIYVDGADEINGHMQMIKGGGAALTREKIIASVAEKFICIADAS
KQVDILGKFPLPVEVIPMARSAVARQLVKLGGRPEYRQGVVTDNGNVILDVHGMEILDPI
AMENAINAIPGVVTVGLFANRGADVALIGTPDGVKTIVK
NT seq 660 nt   +upstreamnt  +downstreamnt
atgacgcaggatgaattgaaaaaagcagtaggatgggcggcacttcagtatgttcagccc
ggcaccattgttggtgtaggtacaggttccaccgccgcacactttattgacgcactcggt
acaatgaaaggccagattgaaggggccgtttccagttcagatgcttccactgaaaaactg
aaaagcctcggcattcacgtttttgatctcaacgaagtcgacagccttggcatctacgtt
gatggcgcagatgaaatcaacggccacatgcaaatgatcaaaggcggcggcgcggcgctg
acccgtgaaaaaatcattgcttcggttgcggaaaaatttatctgtattgcagacgcttcc
aagcaggttgatattctgggcaaattcccgctgccagtagaagttatcccgatggcacgt
agtgcagtggcgcgccagctggtgaaactgggcggtcgtccggaataccgtcagggcgta
gtgaccgataacggcaacgtgatcctcgacgtccacggcatggaaatccttgacccgata
gcgatggaaaacgccataaatgcgattcctggcgtggtgactgttggtttgtttgctaac
cgtggcgcggacgttgcgctgattggcacacctgacggtgtcaaaactattgtgaaatga

DBGET integrated database retrieval system