KEGG   Escherichia coli NA114 (UPEC): ECNA114_2957
Entry
ECNA114_2957      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: LysR_substrate
Other DBs
NCBI-ProteinID: AEG37794
Position
complement(3043661..3043891)
AA seq 76 aa
MHFAQRVRALVVLNGVALLPQFACKQGLANGELVRLFAPWSGIPRPLYALFAGRKGMPAI
ARYFMDELTTRLANGV
NT seq 231 nt   +upstreamnt  +downstreamnt
atgcatttcgctcagcgagttcgcgccctggttgtgttgaatggcgtggcgttattgcct
cagtttgcctgtaaacaggggcttgcgaacggggaactggtgcgcctgttcgcaccgtgg
agcggcatacccagaccgttgtatgctttatttgcggggcgaaaagggatgcccgccatt
gcgcgatattttatggatgagttaaccacgcggcttgccaacggggtctga

DBGET integrated database retrieval system