KEGG   Escherichia coli NA114 (UPEC): ECNA114_2959
Entry
ECNA114_2959      CDS       T01998                                 

Gene name
iciA
Definition
(GenBank) Chromosome initiation inhibitor protein
  KO
K05596  LysR family transcriptional regulator, chromosome initiation inhibitor
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ena03000]
    ECNA114_2959 (iciA)
   03036 Chromosome and associated proteins [BR:ena03036]
    ECNA114_2959 (iciA)
Transcription factors [BR:ena03000]
 Prokaryotic type
  Helix-turn-helix
   LysR family
    ECNA114_2959 (iciA)
Chromosome and associated proteins [BR:ena03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    ECNA114_2959 (iciA)
SSDB
Motif
Pfam: HTH_1 LysR_substrate HTH_30
Other DBs
NCBI-ProteinID: AEG37796
Position
3044032..3044925
AA seq 297 aa
MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENMFGQPLLVRTVPPRPT
EQGQKLLALLRQVELLEEEWLGDEQTGSTPLLLSLAVNADSLATWLLPALAPVLADSPIR
LNLQVEDETRTQERLRRGEVVGAVSIQHQALPSCLVDKLGALDYLFVSSKPFAEKYFPNG
VTRSALLKAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVNSSEAFVQLARQGTTCCMI
PHLQIEKELASGELIDLTPGLFQRRMLYWHRFAPESRMMRKVTDALLDYGHKVLRQD
NT seq 894 nt   +upstreamnt  +downstreamnt
atgaaacgcccggactacagaacattacaggcactggatgcggtgatacgtgaacgagga
tttgagcgcgcggcacaaaagctgtgcattacacaatcagccgtctcacagcgcattaag
caactggaaaatatgttcgggcagccgttgttagtgcgtaccgtaccgccgcgcccgacg
gaacaagggcaaaaactgttggcgctactacgccaggtggagctgctggaagaagagtgg
ctgggcgatgaacaaaccggttcgactccgctgctgctttcactggcggtcaacgccgac
agtctggcgacgtggttgcttccggcactggctcctgtgttggctgattcgcccatccgc
ctcaacttgcaggtagaagatgaaacccgcactcaggaacgtctgcgtcgcggcgaagtg
gtcggcgcagtgagtattcaacatcaggcgctgccgagttgtcttgtcgataaactcggt
gcgctcgactatctgttcgtcagctcaaaaccatttgccgaaaaatatttccctaacggc
gtaacgcgttcggcattactgaaagcgccagtggtcgcgtttgaccatcttgacgatatg
caccaggcctttttgcagcaaaatttcgatctgcctcctggcagcgtaccctgccatatc
gttaattcttcggaagcgttcgtgcaacttgctcgtcagggcaccacctgctgtatgatc
ccgcacctgcaaatcgagaaagagctggccagcggcgaactgattgacttaacgccaggg
ctatttcaacgccggatgctctactggcaccgctttgctcctgaaagccgcatgatgcgt
aaagtcactgatgcgttgctcgattatggtcacaaagttcttcgtcaggattaa

DBGET integrated database retrieval system