KEGG   Escherichia coli NA114 (UPEC): ECNA114_2960
Entry
ECNA114_2960      CDS       T01998                                 

Definition
(GenBank) Methylmalonyl-CoA mutase
  KO
K01848  methylmalonyl-CoA mutase, N-terminal domain [EC:5.4.99.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00280  Valine, leucine and isoleucine degradation
ena00630  Glyoxylate and dicarboxylate metabolism
ena00640  Propanoate metabolism
ena01100  Metabolic pathways
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECNA114_2960
   00640 Propanoate metabolism
    ECNA114_2960
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNA114_2960
Enzymes [BR:ena01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     ECNA114_2960
SSDB
Motif
Pfam: MM_CoA_mutase RE_Eco29kI
Other DBs
NCBI-ProteinID: AEG37797
Position
3045128..3046183
AA seq 351 aa
MSNVQEWQQLANKELSRREKTVDSLVQQTAEGIAIKPLYTEADLDNLEVTGTLPGLPPYV
RGPRATMYTAQPWTIRQYAGFSTAKESNAFYRRNLATHRGYDSDNPRVAGDVGKAGVAID
TVEDIKVLFDQIPLDKMSVSMTMNGAVLPVLAFYIVAAEEQGVTSDKLTGTIQNDILKEY
LCRNTYIYPPKPSMRIIADIIAWCSGNMPRFNTISISGYHMGEAGANCVQQVAFTLADRI
EYIKAAISAGLKIDDFAPRLSFFFGIGMDLFMNVAMLRAARYLWSEAVSGFGAQDPYNNV
IRTTIDHCAHPMYRDYLHRYLENASGGHIHHDLSHVFDLHRNLIATGSMLG
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgtctaacgtgcaggagtggcaacagcttgccaacaaggaattgagccgtcgggagaaa
actgtcgactcgctggttcagcaaaccgcggaagggatcgccatcaagccgctgtatacc
gaagccgatctcgataatctggaggtgacgggtacccttcctggtttgcccccctacgtt
cgtggcccgcgtgccactatgtataccgcccaaccgtggaccatccgtcagtatgctggt
ttctcgacagcaaaagagtccaacgctttttatcgccgtaacctggccacccaccgaggc
tacgactccgataacccacgcgtggcgggcgacgtcggcaaagcgggcgtcgctatcgac
accgtggaagatataaaagtcctgttcgaccagatcccgctggataaaatgtcggtttcg
atgaccatgaatggcgcagtgctaccagtactggcgttttatatcgtcgccgcagaagag
caaggtgttacatccgataaactgaccggcaccattcaaaacgatatcctcaaagagtat
ctttgccgcaacacctatatttacccaccaaaaccgtcaatgcgtattatcgcagacatc
atcgcctggtgttccggcaacatgccgcgatttaataccatcagtatcagcggttaccac
atgggtgaagcgggtgccaactgcgtgcagcaggtagcatttacgctcgccgataggatt
gagtacatcaaagcagcaatctccgccgggctgaaaattgatgacttcgcccctcgcctg
tcgtttttcttcggcattggcatggatctgtttatgaacgtcgccatgttgcgtgcggca
cgttatttatggagcgaagcggtcagtggatttggcgcacaggatccgtataacaacgtt
atccgcaccaccattgatcattgtgcacatcccatgtatcgggattatctgcatcgatat
ctggaaaatgcgtccggcggacatattcaccacgatcttagccacgtcttcgacttacac
cgtaatttaattgcaaccggatcgatgctgggttaa

DBGET integrated database retrieval system