KEGG   Escherichia coli NA114 (UPEC): ECNA114_2961
Entry
ECNA114_2961      CDS       T01998                                 

Gene name
ygfI1
Definition
(GenBank) putative LYSR-type transcriptional regulator
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: LysR_substrate
Other DBs
NCBI-ProteinID: AEG37798
Position
complement(3046180..3046491)
AA seq 103 aa
MRFQNRANFEAMIDANMRPCGINPTIIYRPYSFMAKISAVERGHFLTVIPHFAWRLVNPA
TLKYFDAPHRPMYMQEYLYSIRNHRYTATMLQHIAEDRDGTNH
NT seq 312 nt   +upstreamnt  +downstreamnt
atgcgctttcaaaaccgggctaacttcgaagcaatgattgatgcgaatatgcgtccttgt
gggatcaatccaaccattatttatcgtccctatagttttatggctaaaatcagcgccgtg
gagcggggacattttctgacggtgatcccgcattttgcctggcgactggtgaatccggca
acgctgaaatattttgatgcgccgcacaggccgatgtatatgcaggaatatctttattca
atcagaaatcatcgttataccgccacgatgcttcagcatattgctgaagatcgtgacggg
acaaaccattaa

DBGET integrated database retrieval system