KEGG   Escherichia coli NA114 (UPEC): ECNA114_29612
Entry
ECNA114_29612     CDS       T01998                                 

Gene name
ygfI3
Definition
(GenBank) putative LYSR-type transcriptional regulator
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: HTH_1
Other DBs
NCBI-ProteinID: AEG37800
Position
complement(3046801..3047076)
AA seq 91 aa
MDIFISKKMRNFILLAQTNNIARAAEKIHMTASPFGKSIAALEEQIGYTLFTRKDNNISL
NKAGQELYQKLFPVYQRLSAIDNEIHNSGRR
NT seq 276 nt   +upstreamnt  +downstreamnt
atggacatttttatttcgaaaaagatgcgcaatttcattttattagcgcaaaccaataat
attgcccgggcggcagaaaaaatccatatgacggcttcgccatttggcaaaagcattgcc
gcgctggaagaacaaattggctatacgctatttacccgcaaagataataatatcagcctc
aataaagccggacaggaactgtatcaaaaactgttcccggtttatcaacgactttctgcg
attgataatgaaatccataactcaggacgtcgttaa

DBGET integrated database retrieval system