KEGG   Escherichia coli NA114 (UPEC): ECNA114_2963
Entry
ECNA114_2963      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K06895  L-lysine exporter family protein LysE/ArgO
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2963
Transporters [BR:ena02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   ECNA114_2963
SSDB
Motif
Pfam: LysE
Other DBs
NCBI-ProteinID: AEG37802
Position
complement(3048077..3048670)
AA seq 197 aa
MILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSALLMQSPWLLALVTW
GGVAFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVTWLNPHVYLDTFVVLG
SLGGQLDVEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAKSQRIINLVVGCVMWFI
ALQLARDGIAHAQALFS
NT seq 594 nt   +upstreamnt  +downstreamnt
atgatcctaccgctcggtccacaaaatgcttttgtgatgaatcagggcattcgtcgtcag
taccacattatgattgccttactttgtgctatcagcgatttggtcctgatttgtgcgggg
atttttggtggcagcgcgttattgatgcagtcgccgtggttgctggcgctggtcacctgg
ggcggcgtagccttcttgctgtggtatggttttggcgcttttaaaacagcaatgagcagt
aacattgagttagccagtgccgaagtcctgaaacaaggcagatggaaaattatcgccacc
atgttggcagtgacctggctgaatccgcatgtttacctggatacttttgttgtgctgggc
agccttggcgggcaacttgatgtggaaccaaaacgttggtttgcgctcgggacaattagc
gcctctttcctgtggttctttggtctggctattctcgcagcctggctggcaccgcgcctg
cgcacggcaaaatcacagcgcattatcaatctggtagtgggatgtgttatgtggtttatt
gccttgcagctggcgagagacggtattgctcatgcacaagccttgttcagttag

DBGET integrated database retrieval system