KEGG   Escherichia coli NA114 (UPEC): ECNA114_2964
Entry
ECNA114_2964      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K03442  small conductance mechanosensitive channel
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2964
Transporters [BR:ena02000]
 Other transporters
  Pores ion channels [TC:1]
   ECNA114_2964
SSDB
Motif
Pfam: MS_channel TM_helix
Other DBs
NCBI-ProteinID: AEG37803
Structure
PDB: 

Position
complement(3048851..3049711)
AA seq 286 aa
MEDLNVVDSINGAGSWLVANQALLLSYAVNIVAALAIIIVGLIIARMISNAVNRLMISRK
IDATVADFLSALVRYGIIAFTLIAALGRVGVQTASVIAVLGAAGLAVGLALQGSLSNLAA
GVLLVMFRPFRAGEYVDLGGVAGTVLSVQIFSTTMRTADGKIIVIPNGKIIAGNIINFSR
EPARRNEFIIGVAYDSDIDQVKQILTDIIQSEDRILKDREMTVRLNELGASSINFVVRVW
SNSGDLQNVYWDVLERIKREFDAAGISFPYPQMDVNFKRVKEDKAA
NT seq 861 nt   +upstreamnt  +downstreamnt
atggaagatttgaatgttgtcgatagcataaacggcgcgggaagctggctggtggctaac
caggcgctgctgctaagttatgcagtaaacatcgtggcggcactcgcgatcatcatcgtt
ggtttgattatcgcgcggatgatttccaacgcggtgaatcgcctgatgatctcccgtaaa
atcgatgccactgttgctgattttctttctgcattagtccgttacggaattatcgccttt
acgctaatcgctgcactggggcgcgtgggcgtacaaacagcgtcagtcattgctgtactc
ggtgccgcaggcttagctgttggtctggctttgcaggggtcactgtctaacctggccgct
ggcgtgttacttgtcatgttccgcccgttccgtgccggtgaatatgttgacctcggcggc
gtagccggcactgtgctgagtgtgcagattttctccaccaccatgcgtactgcagacggt
aaaattatcgttattccgaatggtaaaattattgccgggaatattattaacttctcccgc
gagccagctcgccgtaacgaatttattattggcgtggcgtatgattccgatatcgatcag
gttaagcagatcctgaccgatattatccagtctgaagatcgcattttgaaagatcgcgaa
atgactgtgcgtctgaacgaacttggtgcatcgtcgattaatttcgtggtccgagtctgg
agcaacagcggcgatctgcaaaacgtgtactgggatgtgctggagcgtattaaacgtgaa
tttgatgccgccggtatcagcttcccgtatccgcaaatggatgtgaactttaagcgggtg
aaagaagacaaagctgcgtaa

DBGET integrated database retrieval system