KEGG   Escherichia coli NA114 (UPEC): ECNA114_2965
Entry
ECNA114_2965      CDS       T01998                                 

Gene name
fba
Definition
(GenBank) Fructose-bisphosphate class II aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena00030  Pentose phosphate pathway
ena00051  Fructose and mannose metabolism
ena00680  Methane metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ena_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_2965 (fba)
   00030 Pentose phosphate pathway
    ECNA114_2965 (fba)
   00051 Fructose and mannose metabolism
    ECNA114_2965 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    ECNA114_2965 (fba)
Enzymes [BR:ena01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     ECNA114_2965 (fba)
SSDB
Motif
Pfam: F_bP_aldolase MR_MLE_C S-methyl_trans
Other DBs
NCBI-ProteinID: AEG37804
Structure
PDB: 

Position
complement(3049902..3050981)
AA seq 359 aa
MSKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQ
FSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWI
DGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTG
GEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPT
ILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGV
LNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtctaagatttttgatttcgtaaaacctggcgtaatcactggtgatgacgtacagaaa
gttttccaggtagcaaaagaaaacaacttcgcactgccagcagtaaactgcgtcggtact
gactccatcaacgccgtgctggaaaccgctgctaaagttaaagcgccggttatcgttcag
ttctccaacggtggtgcttcctttatcgctggtaaaggcgtgaaatctgacgttccgcag
ggtgctgctatcctgggcgcgatctctggtgcgcatcacgttcaccagatggctgaacat
tatggtgttccggttatcctgcacaccgaccactgcgcgaagaaactgctgccgtggatc
gacggtctgctggacgcgggtgaaaaacacttcgcagctaccggcaagccgctgttctct
tctcacatgatcgacctgtctgaagaatctctgcaagagaacatcgaaatctgctctaaa
tacctggagcgcatgtccaaaatcggcatgactctggaaatcgaactgggttgcaccggt
ggtgaagaagacggcgtggacaacagccacatggacgcttctgcactgtacacccagccg
gaagacgttgattatgcgtataccgagctgagcaaaatcagcccgcgtttcaccatcgca
gcgtccttcggtaacgtacacggtgtttacaagccgggtaacgttgttctgactccgacc
atcctgcgcgactctcaggaatatgtttctaagaaacacaacctgccgcacaacagcctg
aacttcgtattccacggtggttccggttctactgctcaggaaatcaaagactccgtaagc
tacggcgtagtgaaaatgaacatcgataccgatacccaatgggcaacctgggaaggcgtt
ctgaactactacaaagcgaacgaagcttacctgcagggtcagctgggtaacccgaaaggc
gaagatcagccgaacaagaaatactacgatccgcgcgtatggctgcgtgccggtcagact
tcgatgatcgctcgtctggaaaaagcattccaggaactgaacgcgatcgacgttctgtaa

DBGET integrated database retrieval system