KEGG   Escherichia coli NA114 (UPEC): ECNA114_2966
Entry
ECNA114_2966      CDS       T01998                                 

Gene name
pgk
Definition
(GenBank) Phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ena_M00002  Glycolysis, core module involving three-carbon compounds
ena_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
ena_M00552  D-galactonate degradation, De Ley-Doudoroff pathway, D-galactonate => glycerate-3P
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_2966 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ena04147]
    ECNA114_2966 (pgk)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     ECNA114_2966 (pgk)
Exosome [BR:ena04147]
 Exosomal proteins
  Proteins found in most exosomes
   ECNA114_2966 (pgk)
SSDB
Motif
Pfam: PGK Fucose_iso_C
Other DBs
NCBI-ProteinID: AEG37805
Structure
PDB: 
1ZMR

Position
complement(3051195..3052358)
AA seq 387 aa
MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRASLPTIELALKQGAKVMVTSHL
GRPTEGEYNEEFSLLPVVNYLKDKLSNPVRLVKDYLDGVDVAEGELVVLENVRFNKGEKK
DDETLSKKYAALCDVFVMDAFGTAHRAQASTHGIGKFADVACAGPLLAAELDALGKALKE
PARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFIAAQGHDVGKSLYEADLVD
EAKRLLTTCNIPVPSDVRVATEFSETAPATLKSVNDVKADEQILDIGDASAQELAEILKN
AKTILWNGPVGVFEFPNFRKGTEIVANAIADSEAFSIAGGGDTLAAIDLFGIADKISYIS
TGGGAFLEFVEGKVLPAVAMLEERAKK
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtctgtaattaagatgaccgatctggatcttgctgggaaacgtgtatttatccgtgcg
gatctgaacgtaccagtaaaagacgggaaagtaaccagcgacgcgcgtatccgtgcttct
ctgccgaccatcgaactggccctgaaacaaggcgcaaaagtgatggtaacttcccacctg
ggtcgtcctaccgaaggcgagtacaacgaagaattctctctgctgccggttgttaactac
ctgaaagacaaactgtctaacccggttcgtctggttaaagattacctcgacggcgttgac
gttgctgaaggtgaactggttgttctggaaaacgttcgcttcaacaaaggcgagaagaaa
gacgacgaaactctgtccaaaaaatacgctgcactgtgtgacgtgttcgtaatggacgca
ttcggtactgctcaccgcgcgcaggcttctactcacggtatcggtaaattcgctgacgtt
gcgtgcgcaggcccgctgctggcagctgaactggacgcgctgggtaaagcactgaaagaa
cctgctcgcccgatggtggctatcgttggtggttctaaagtatctaccaaactgaccgtt
ctggactccctgtctaaaatcgctgaccagctgatcgttggtggtggtattgctaacacc
tttattgcggcacaaggccacgatgtgggtaaatccctgtacgaagctgacctggttgac
gaagctaaacgtctgctgaccacctgcaacatcccggttccgtctgatgttcgcgtagca
accgagttctctgaaactgcaccggctaccctgaaatctgttaacgatgtgaaagctgac
gagcagatcctggatatcggtgatgcttccgctcaggaactggctgaaatcctgaagaat
gcgaaaaccattctgtggaacggtccggttggcgtgttcgaattcccgaacttccgcaaa
ggtactgaaatcgtggctaacgctatcgcagacagcgaagcgttctccatcgctggcggc
ggcgacactctggcagcaatcgacctgttcggcattgctgacaaaatctcctacatctcc
actggcggcggcgcattcctcgaattcgtggaaggtaaagtactgcctgcagtagcgatg
ctcgaagagcgcgctaagaagtaa

DBGET integrated database retrieval system