KEGG   Escherichia coli NA114 (UPEC): ECNA114_2967
Entry
ECNA114_2967      CDS       T01998                                 

Gene name
epd
Definition
(GenBank) D-erythrose-4-phosphate dehydrogenase
  KO
K03472  D-erythrose 4-phosphate dehydrogenase [EC:1.2.1.72]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00750  Vitamin B6 metabolism
ena01100  Metabolic pathways
Module
ena_M00124  Pyridoxal biosynthesis, erythrose-4P => pyridoxal-5P
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ECNA114_2967 (epd)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.72  erythrose-4-phosphate dehydrogenase
     ECNA114_2967 (epd)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3 DapB_N TrkA_N GFO_IDH_MocA
Other DBs
NCBI-ProteinID: AEG37806
Structure
PDB: 
2X5J 2X5K 2XF8

Position
complement(3052408..3053427)
AA seq 339 aa
MTVRVAINGFGRIGRNVVRALYESGRRAEITVVAINELADAAGMAHLLKYDTSHGRFAWE
VRQERDQLFVGDDAIRVLHERSLQSLPWRELGVDVVLDCTGVYGSREHGEAHIAAGAKKV
LFSHPGSNDLDATVVYGVNQDQLRAEHRIVSNASCTTNCIIPVIKLLDDAYGIESGTVTT
IHSAMHDQQVIDAYHPDLRRTRAASQSIIPVDTKLAAGITRFFPQFNDRFEAIAVRVPTI
NVTAIDLSVTVKKPVKANEVNLLLQKAAQGAFHGIVDYTELPLVSVDFNHDPHSAIVDGT
QTRVSGAHLIKTLVWCDNEWGFANRMLDTTLAMATVAFR
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgaccgtacgcgtagcgataaatggcttcggtcgcatcgggcgtaatgtggttcgtgct
ttgtatgaatccggacgccgtgcggaaattaccgtggtggcaatcaacgaactggcggat
gctgcgggcatggcgcatttgttgaaatatgacaccagccatggccgttttgcatgggaa
gtacgacaggaacgcgatcaactttttgttggtgatgacgccatccgtgtattgcatgaa
cgttcactgcaatcgctcccctggcgtgaacttggcgttgatgtagtcctcgactgcacc
ggcgtatatggctcccgcgagcatggtgaagcacacattgccgccggggctaaaaaagtg
ctcttttcacatcctggcagtaacgatctcgacgcgaccgttgtttatggcgtcaatcag
gatcaacttcgtgcggaacaccgcatcgtttctaatgcttcctgtaccacgaattgcata
attcccgtcatcaaattgttagatgatgcgtacggtattgagtctggcactgtgaccaca
attcactccgccatgcatgatcaacaggttattgatgcataccatcctgacctgcgtcgc
actcgggcagccagtcagtcgatcattccggtcgatactaaactggccgccggtatcaca
cgattttttccgcaatttaacgatcgctttgaggcgattgcggtacgtgtgccaaccata
aatgtgacggcaatcgatttaagcgtgacggtgaagaaacctgtaaaagccaatgaagtc
aacctgttgctgcaaaaagcagcacaaggtgcatttcatggtatagttgactatacggaa
ttgccgttggtctctgtagattttaaccacgatccgcacagtgccattgtcgatggcact
caaacccgggtcagtggcgcacacctgatcaaaacgttggtctggtgcgataacgaatgg
ggctttgctaaccgaatgctcgacacgacgttagctatggctactgttgctttcaggtaa

DBGET integrated database retrieval system