KEGG   Escherichia coli NA114 (UPEC): ECNA114_2968
Entry
ECNA114_2968      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K06934  uncharacterized protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    ECNA114_2968
SSDB
Motif
Pfam: PCC DUF4381
Other DBs
NCBI-ProteinID: AEG37807
Position
3053799..3054230
AA seq 143 aa
MMTLPYPYSSSARFYALRLLPGQEVLSQLRAFAQQQQLHAAWIAGCTGSLTDVALRYAGQ
ENTALLSGKFEVIALNGTLEQSGEHLHLCVSDPHGTMLGGHMMPGCTVRTTLELVIGCLE
ELAFSRQLCALSGYDELHISPVK
NT seq 432 nt   +upstreamnt  +downstreamnt
atgatgacattgccctacccatattcttcctccgcacgcttttacgcgctgcgcctgctc
cccgggcaggaagttctctcccaattacgcgccttcgcgcagcaacaacaacttcacgcc
gcgtggattgcaggttgtaccggcagtctgactgacgtcgccttacgctatgccgggcaa
gaaaacactgccctgctaagcggtaagttcgaagtcatcgcattgaacggcacgctggaa
cagagtggtgaacatcttcatctctgcgtttccgatccacacggcacgatgcttggcggt
catatgatgcccggctgtaccgtgcggaccacgcttgaactggtgatcggctgccttgag
gaactggcgtttagccgccagctttgcgcgctttctggttacgacgagttgcatatttcc
cccgttaaataa

DBGET integrated database retrieval system