KEGG   Escherichia coli NA114 (UPEC): ECNA114_2969
Entry
ECNA114_2969      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
  KO
K16923  energy-coupling factor transport system substrate-specific component
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2969
Transporters [BR:ena02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Substrate-specific components
     ECNA114_2969
SSDB
Motif
Pfam: ECF_trnsprt TMEM18
Other DBs
NCBI-ProteinID: AEG37808
Position
3054253..3054831
AA seq 192 aa
MARRHFSSQALVLIVISIAINMIGGQLASMVKLPIFLDSIGTLISAVLLGPIIGMLTGLL
TNLLWGLLTDPIAAAFAPVAMVIGLVAGWLARAGWFRTLPKVVVSGVIITLAVTVVAVPL
RTALFGGVTGSGADLFVAWMHSMGQNLVESVAITVIGANLVDKILTAVIVWLLLRQLPIR
TTRHFPAMAAVR
NT seq 579 nt   +upstreamnt  +downstreamnt
atggcgcgtcgccacttttccagtcaggcactggtgttgatcgttatctctatcgccatc
aatatgatcggcgggcaactggccagcatggttaaattacctatttttctcgactccatc
ggcacacttattagcgcggtactgcttggtccgataatcgggatgctgaccggtttactg
accaatttactctggggattgctgaccgacccgatcgccgccgcatttgcgcccgtcgcg
atggtcatcggcctggtcgccggttggctggcgcgagcgggttggtttcgcaccctgcca
aaagtcgttgttagcggcgtgattattacgcttgcggtaacggtcgtcgctgtaccgctg
cgtactgcgctgttcggcggcgtgacaggaagcggagccgatttgttcgttgcctggatg
cactcgatggggcaaaacctggtggagtcggtggcgattacggtgataggcgcgaacctg
gtcgataaaattcttacagcggtgatagtctggcttttactgcgtcagctgccgattcgc
accacgcgccattttccggcaatggctgccgtgcgctaa

DBGET integrated database retrieval system