KEGG   Escherichia coli NA114 (UPEC): ECNA114_2970
Entry
ECNA114_2970      CDS       T01998                                 

Definition
(GenBank) cobalt ABC transporter permease
  KO
K16785  energy-coupling factor transport system permease protein
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECNA114_2970
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2970
Transporters [BR:ena02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     ECNA114_2970
SSDB
Motif
Pfam: CbiQ
Other DBs
NCBI-ProteinID: AEG37809
Position
3054832..3055539
AA seq 235 aa
MHPFTSLTLWALAACTTLILPTQTILPVYSAATFFCLIALKATRRRAKYVVWLMFSLGAG
LWLVHGGWLTEWLSGTPHSPERWAHAITLWLRILAIVSTSQLWMQYVPVQRFIRALFASR
LPPGVAYLFAGPLLVVEQLKRQLAIIHEAQCARGVPLDEGWYQRLRAMPALIIPLTHNAL
NDLAVRGAALDMRAFRINNRRTTLWAPADSTLQCVARYAMILLMLAEFGAWIWLR
NT seq 708 nt   +upstreamnt  +downstreamnt
atgcatccttttacatccttaacgctgtgggcgctggcggcctgcaccacgcttatcctg
cctacacagacaatattgccagtctatagcgcggcgacctttttctgccttattgcgcta
aaggccacgcggcggcgggcaaaatatgtcgtctggctgatgttctcgctgggggctgga
ctgtggctggtgcacggtggctggctgacagaatggctaagcggcacgccacactctcca
gaacggtgggcgcatgctattacgctctggttgcggattctggcgattgtttcaacctca
cagttgtggatgcagtacgtccccgtgcaacgttttatccgcgctttgtttgcttctcgc
ctgccgccgggcgtcgcttatctgtttgccgggccgttattggtcgttgagcagttaaaa
cggcaattggcgattattcatgaagcgcagtgcgcccgcggcgtgccgctggatgagggc
tggtatcagcgtttacgtgcgatgcccgcgttaattattccgctaacacacaatgcgcta
aacgatcttgctgtccgtggtgcggcgctggatatgcgggcatttcgaatcaacaatagg
cgcactacgttatgggcaccagccgatagcaccctacaatgcgtagcacgttacgccatg
atattgctaatgctggctgaattcggagcgtggatatggttacgttag

DBGET integrated database retrieval system