KEGG   Escherichia coli NA114 (UPEC): ECNA114_2971
Entry
ECNA114_2971      CDS       T01998                                 

Definition
(GenBank) cobalt ABC transporter ATP-binding protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECNA114_2971
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2971
Enzymes [BR:ena01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Catalysing transmembrane movement of substances
    3.6.3.-  
     ECNA114_2971
Transporters [BR:ena02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     ECNA114_2971
SSDB
Motif
Pfam: ABC_tran AAA_23 AAA_22 SbcCD_C SMC_N AAA_29 AAA_16 AAA_21 AAA_13 NACHT AAA_24 DUF87
Other DBs
NCBI-ProteinID: AEG37810
Position
3055521..3056204
AA seq 227 aa
MDMVTLEQFRYCPTHSTHPPFCYDFHYVKPGMVAIFGDNGSGKSTLAQLMAGWYPDFLPG
EITGTGTLLGTPIGRLPLNEQSATIQLVQQSPYLQLSGCTFSVEEEVAFGPENLCLAEKE
IMARIDAALALTECQPLRHRHPATLSGGETQRVVIACAIAMQPKLLILDEAFSRLTPQAR
EMLLQRLQHWALERGSLIILFERHHTPFLNHCQQAWQLQNGALQPLC
NT seq 684 nt   +upstreamnt  +downstreamnt
gtggatatggttacgttagaacagtttcgctattgcccgacacactcaacgcatcctccg
ttctgttatgactttcactatgtcaaaccggggatggtcgccatctttggtgacaacggc
agtggcaaaagtacgctggcacagctgatggcgggctggtatccggactttctaccagga
gagataaccggcacggggacgcttctcggtacgcccattgggcgtctcccgcttaatgaa
caatccgccaccatccagctcgtccagcaatcgccctatttgcagctctccggctgtacc
tttagcgtggaagaagaagttgcctttgggccagaaaatctgtgtcttgctgaaaaagag
attatggcgcggattgacgccgccctggccctgaccgagtgccagccgttgcgccatcgt
cacccggcaacactctccggtggagagacacagcgtgtggtcatcgcctgcgccatcgcg
atgcagccaaagctcttaattcttgatgaagcctttagccgcctgacgccgcaggcccgc
gaaatgctgttgcagcgcttacaacactgggcgcttgaacgtggttcgctgattattctt
tttgaacgtcatcacacacctttcctgaaccactgccagcaagcgtggcaattgcaaaac
ggagcgctccagccactatgttaa

DBGET integrated database retrieval system