KEGG   Escherichia coli NA114 (UPEC): ECNA114_2972
Entry
ECNA114_2972      CDS       T01998                                 

Definition
(GenBank) cobalt ABC transporter ATP-binding protein
  KO
K16787  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ena00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECNA114_2972
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2972
Enzymes [BR:ena01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Catalysing transmembrane movement of substances
    3.6.3.-  
     ECNA114_2972
Transporters [BR:ena02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Shared module
     ECNA114_2972
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 SMC_N AAA_23 RsgA_GTPase AAA_33 TsaE Mg_chelatase NACHT Zeta_toxin AAA_15 AAA_30 AAA_22 AAA_5 AAA_25 PRK
Other DBs
NCBI-ProteinID: AEG37811
Position
3056198..3056875
AA seq 225 aa
MLTLNQISYRWPGAATDCLCDISLQLKQGEWLALTGDNGAGKSTLLRVMAGLLTPTAGTV
MLQQQAMKNLKNRQRAAKIGVLFQEAENQLFHSTVADEIAFGLILQKCPADEITQRTNAA
LQCCQLADTASAHPLDLHSAQRRMVAVACLEALSPPLLLLDEPSRDFDENWLSVFESWLE
KCRQRGTSVVAISHDAAFTRRHFSRVVRLEDGVIRNVNPSDDIHP
NT seq 678 nt   +upstreamnt  +downstreamnt
atgttaacgttaaatcagatatcttatcgctggcctggcgcggctacggattgtctttgc
gacatttctctgcaactcaaacaaggtgaatggctggcgctgaccggcgacaatggcgcg
ggaaaatcgacgctgttacgagtaatggcaggtcttcttacgcccacagccggtacggtt
atgctgcaacaacaagcgatgaaaaacctgaaaaaccgccagcgcgcggcaaagattggc
gtactgtttcaggaagcggaaaatcagctttttcacagcaccgttgctgacgaaatcgca
tttggtttgatactgcaaaaatgcccggcggatgaaatcactcaacgtaccaatgctgcc
ctgcaatgctgtcagttagcagacactgccagcgcgcatccgttagatctgcatagtgcg
cagcgacggatggtcgccgtcgcctgcctggaagcactctctccgccactattgctactg
gacgagccgagtcgggattttgacgaaaattggttgagcgtgtttgaaagctggctggaa
aagtgccgccagcgaggcacgagcgtcgtagcaatcagtcatgacgccgcatttacccgg
cgtcatttctctcgtgtggtgcgactggaagatggtgtaatcaggaacgttaatccatca
gacgatattcacccgtag

DBGET integrated database retrieval system