KEGG   Escherichia coli NA114 (UPEC): ECNA114_2973
Entry
ECNA114_2973      CDS       T01998                                 

Gene name
yggC1
Definition
(GenBank) hypothetical protein
  KO
K02173  putative kinase
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    ECNA114_2973 (yggC1)
SSDB
Motif
Pfam: AAA_16 AAA_22 AAA_18 AAA_25 AAA_19 AAA_30
Other DBs
NCBI-ProteinID: AEG37812
Position
complement(3056847..3057560)
AA seq 237 aa
MKIELTVNGLKVQAQYSDDEIENVHKPLLRMLAALQTVNPQRRTVVFLCAPPGTGKSTLT
TFWEYLAQQDPELPAIQTLPMDGFHHYNSWLDVHQLRPFKGAPETFNVAKLAENLCRVVE
GDCTWPQYDRQKHDPVEDVLHVTAPLVIVEGNWLLLDDEKWCQLAQFCDFSIFIKAPASA
LRERLVGRKLAGGLSLADAEAFYDRTDGPNVRRVLEESLPANLTLMMTATGEYRLMD
NT seq 714 nt   +upstreamnt  +downstreamnt
gtgaaaatcgaactgacggtgaatggactaaaggtacaggcgcagtactctgatgatgaa
attgaaaatgtacataaaccattgctgcgtatgctggcggccttacagacagtaaatccg
cagcggcgtacggtggtttttctttgcgctccgccggggacgggtaaatctaccctaacc
accttctgggaatatctcgcgcaacaagacccggaactgcccgctattcagacgctgccg
atggatggttttcaccattacaatagctggctggatgtgcatcaattgcgacccttcaaa
ggcgcaccagagacattcaacgttgcgaaactggcggaaaatctgtgccgggttgtggaa
ggggattgtacgtggccgcagtacgatcgacaaaagcatgatcctgttgaagatgtgttg
cacgttaccgcaccactcgtcatcgtcgaaggaaactggttgttgttggacgacgagaag
tggtgccagcttgcgcaattttgtgatttctcgatctttatcaaagctcccgcatctgcg
ttgcgggagcgtctggtggggcgcaagctggcgggagggttatcgctggcagacgcagaa
gccttttatgaccgtaccgacgggccgaatgttcgccgggtgctggaagagagtctgcct
gcaaatttgaccttaatgatgaccgctacgggtgaatatcgtctgatggattaa

DBGET integrated database retrieval system