KEGG   Escherichia coli NA114 (UPEC): ECNA114_2974
Entry
ECNA114_2974      CDS       T01998                                 

Definition
(GenBank) Putative transcriptional regulator
  KO
K01774  fumarate hydratase E [EC:4.2.1.2]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00020  Citrate cycle (TCA cycle)
ena00620  Pyruvate metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECNA114_2974
   00620 Pyruvate metabolism
    ECNA114_2974
Enzymes [BR:ena01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     ECNA114_2974
SSDB
Motif
Pfam: MtlR
Other DBs
NCBI-ProteinID: AEG37813
Position
complement(3057557..3058066)
AA seq 169 aa
MATLTEDDVLEQLNAQDNLFSFMKTAHSILLQGIRQFLPSLFVDNDEEIVEYAVKPLLAQ
SGPLDDIDVALRLIYALGKMDKWLYADITHFSQFWHYLNEQDETPRFADDITWDFISNVN
SITRNATLYDALKAMKFADFAVWSEARFSGMVKTALTLAVTTTLKELTP
NT seq 510 nt   +upstreamnt  +downstreamnt
atggcgacgctgacagaagatgatgtgcttgagcaactgaatgcacaggacaatttattt
tcatttatgaaaactgcgcattctattttgctccaggggatacgccagtttctgccgtcg
ctgtttgtcgataacgatgaagagatcgtcgaatatgcagtgaagccgttactcgcccaa
agcggcccgcttgacgatattgatgttgcgctgcgtttgatttatgcgctggggaaaatg
gataaatggctgtacgccgatatcacgcatttttcccagttttggcattacctgaacgaa
caggatgaaacgcccagatttgctgatgacataacctgggattttatcagcaacgtcaat
agcataacccgcaatgcgacgctctatgacgcgttgaaagcgatgaagttcgccgatttc
gccgtctggtcagaggcgcgttttagcgggatggtcaaaacggcgctgacgctggcagta
acgaccaccttaaaggaattaacgccgtga

DBGET integrated database retrieval system