KEGG   Escherichia coli NA114 (UPEC): ECNA114_2975
Entry
ECNA114_2975      CDS       T01998                                 

Gene name
yggF
Definition
(GenBank) hypothetical protein
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00010  Glycolysis / Gluconeogenesis
ena00030  Pentose phosphate pathway
ena00051  Fructose and mannose metabolism
ena00680  Methane metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
Module
ena_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECNA114_2975 (yggF)
   00030 Pentose phosphate pathway
    ECNA114_2975 (yggF)
   00051 Fructose and mannose metabolism
    ECNA114_2975 (yggF)
  09102 Energy metabolism
   00680 Methane metabolism
    ECNA114_2975 (yggF)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     ECNA114_2975 (yggF)
SSDB
Motif
Pfam: FBPase_glpX Adhesin_P1_N
Other DBs
NCBI-ProteinID: AEG37814
Position
complement(3058088..3059053)
AA seq 321 aa
MMSLAWPLFRVTEQAALAAWPQTGCGDKNKIDGLAVTAMRQALNDVAFRGRVVIGEGEID
HAPMLWIGEEVGKGDGPEVDIAVDPIEGTRMVAMGQSNALAVMAFAPRDSLLHAPDMYMK
KLVVNRLAAGAIDLSLPLADNLRNVARALGKPLDKLRMVTLDKPRLSAAIEEATQLGVKV
FALPDGDVAASVLTCWQDNPYDVMYTIGGAPEGVISACAVKALGGDMQAELIDFCQAKGD
YTENRQIAEQERKRCKAMGVDVNRVYSLDELVRGNDILFSATGVTGGELVNGIQQTANGV
RTQTLLIGGADQTCNIIDSLH
NT seq 966 nt   +upstreamnt  +downstreamnt
atgatgtccctggcgtggccattatttcgcgttacggaacaggcagcgttggctgcctgg
ccgcaaaccggctgtggcgacaaaaataaaattgatggccttgcggtcaccgcgatgcgc
caggcattaaacgacgttgcttttcgtgggcgagtggttatcggcgagggggaaattgac
catgcgccgatgctgtggattggcgaagaggtgggcaaaggcgatgggccagaagtcgat
atcgcggtcgatcccattgaaggcacgcggatggtggcgatggggcagagcaatgcgctg
gcggtcatggctttcgcccctcgagatagcctgttacatgcgcccgatatgtatatgaaa
aagctggttgttaatcgactggctgccggggcgatagatctgtctttgcctctggcggac
aacttgcgtaacgtggcgcgggcgttaggtaaaccgctggacaagctgcgcatggttacg
ctggataaaccgcgcctgagtgccgcaattgaggaagcaacacagctcggcgtgaaggtt
tttgccctgccggatggcgatgtcgccgccagcgtgctgacttgctggcaggataatcct
tacgatgtgatgtacaccatcggtggcgcaccggaaggtgttatttctgcctgtgccgtt
aaagcattaggcggggatatgcaggccgagctgattgacttttgtcaggctaaaggggat
tacacggaaaatcggcagattgcagagcaggagcgcaagcgttgcaaggcaatgggcgtt
gacgttaaccgtgtatactcgctcgatgaactggtgagggggaacgatatcctctttagc
gctacgggcgtgacgggcggcgagttggtgaacggtatccaacagacggcgaatggggtg
cggacgcagacattactgatcggcggcgcggaccaaacgtgtaatataatagactccctg
cattga

DBGET integrated database retrieval system