KEGG   Escherichia coli NA114 (UPEC): ECNA114_2976
Entry
ECNA114_2976      CDS       T01998                                 

Gene name
yggC2
Definition
(GenBank) putative oxidoreductase
  KO
K19956  L-sorbose 1-phosphate reductase [EC:1.1.1.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00051  Fructose and mannose metabolism
ena01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECNA114_2976 (yggC2)
Enzymes [BR:ena01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     ECNA114_2976 (yggC2)
SSDB
Motif
Pfam: ADH_zinc_N ADH_N
Other DBs
NCBI-ProteinID: AEG37815
Position
complement(3059050..3060327)
AA seq 425 aa
MKTKVAAIYGKRDVRLREFELPEITDNELLVSVISDSVCLSTWKAALLGSEHKRVPDDLE
NHPVITGHECAGVVVEVGKNLTGKYKKGQRFVLQPAMGLPSGYSAGYSYEYFGGNATYMI
IPEIAINLGCVLPYHGSYFAAASLAEPMCCIIGAYHANYHTTQYVYEHRMGVKPGGNIAL
LACAGPMGIGAIDYAINGGIQPARVVVVDIDDKRLAQVQKLLPVELAASKGIELVYMNTK
GMSDPVQTLRALTDDAGFDDVFVYAAVPSVVEMADELLAEDGCLNFFAGPTDKNFKVPFN
FYNVHYNSTHIVGTSGGSTDDMKEAIALSATGQLQPSFMVTHIGGLDAVPETVLNLPDIP
GGKKLIYNGVTMPLTAIADFAEKGKTDPLFKELARLVEKTHGIWNEQAEKYLLAQFGVDI
GEAAQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgaaaaccaaagttgctgctatttatggcaagcgggatgtccgtctgcgcgaatttgaa
ctgccagaaattactgataatgaactgttagtgagtgtaatttctgacagcgtttgttta
tccacctggaaagcggcgttgcttggtagtgaacataaacgcgtccccgacgatttagaa
aatcatccggttattaccgggcatgaatgtgctggggttgttgtcgaagtgggtaaaaat
ctcactggcaaatataaaaaagggcagcgttttgtattgcaaccggcgatggggctacca
agcggatattcagccggatacagctacgaatattttggtggcaatgccacctatatgatt
attcccgaaatcgcgattaatttaggctgtgtattaccgtatcacggctcttattttgct
gcggcgtcgctggcagagcctatgtgctgcattattggtgcttatcatgccaattatcac
accacgcaatatgtttatgagcatcgtatgggcgtcaaacctggcggcaatattgccctg
ctggcgtgtgctggcccgatgggcattggcgctatcgattacgccattaacggcggcata
caaccggcgcgggtggtggtagtcgatatcgacgacaaacggctggcgcaggtgcagaag
ttgctgccggtggagctggcggccagtaaaggcattgagctggtgtatatgaataccaaa
gggatgagcgatccggtccagacgctgcgggcgctgacggatgatgccggatttgatgac
gtatttgtctatgcagcggtgccttcagtcgtcgagatggctgatgaattactggctgaa
gatggctgcctgaacttctttgccggtccgacggataaaaacttcaaagtgccgtttaat
ttctacaacgtccattacaacagtacgcacattgtcggcacgtctggcggttccacggac
gacatgaaagaggcgattgcccttagcgccacggggcagttacagccgtcgtttatggtg
acccatattggtggcctggatgcggtgccagaaaccgtgctcaatctgccggatatccct
ggcggtaaaaaactcatttataacggcgtgaccatgccgctgaccgccattgccgatttt
gccgaaaaaggcaaaaccgatccgctgtttaaagagctggcgcggctggttgagaaaacg
cacggtatctggaatgaacaggccgagaaatatctgctggcacaatttggcgttgatatt
ggggaggccgcgcaatga

DBGET integrated database retrieval system