KEGG   Escherichia coli NA114 (UPEC): ECNA114_2977
Entry
ECNA114_2977      CDS       T01998                                 

Gene name
cmtA
Definition
(GenBank) PTS system, mannitol-specific cryptic IIBC component protein
  KO
K02800  mannitol PTS system EIICBA or EIICB component [EC:2.7.1.197]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00051  Fructose and mannose metabolism
ena01100  Metabolic pathways
ena02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECNA114_2977 (cmtA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECNA114_2977 (cmtA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2977 (cmtA)
Enzymes [BR:ena01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.197  protein-Npi-phosphohistidine---D-mannitol phosphotransferase
     ECNA114_2977 (cmtA)
Transporters [BR:ena02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Mannitol-specific II component
    ECNA114_2977 (cmtA)
SSDB
Motif
Pfam: PTS_EIIC PTS_IIB DUF1846
Other DBs
NCBI-ProteinID: AEG37816
Position
complement(3060342..3061730)
AA seq 462 aa
MENKSARAKVQAFGGFLTAMVIPNIGAFIAWGFITALFIPTGWLPNEHFAKIVGPMITYL
LPVMIGSTGGHLVGGKRGAVMGGIGTIGVIVGAEIPMFLGSMIMGPLGGLVIKYIDKSLE
KRIPAGFEMVINNFSLGIAGMLFCLLGFEVIGPAVLIANTFVKECIEALVHAGYLPLLSV
INEPAKVLFLNNAIDQGVYYPLGMQQASVNGKSIFFMVASNPGPGLGLLLAFTLFGKGMS
KRSAPGAMIIHFLGGIHELYFPYVLMKPLTIIAMIAGGMSGTWMFNLLDGGLVAGPSPGS
IFAYLALTPKGSFLATIAGVTVGTLVSFAITSLILKMEKTVETKSEDEFTESANAVKAMK
QEGAFSLSRVKRIAFVCDAGMGSSAMGATTFRKRLEKAGLAIEVKHYAIENVPADADIVV
THASLEGRVKRVTDKPLILINNYIGDPKLDTLFNQLTAEHKH
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggaaaacaagtctgctcgtgcaaaggtccaggcttttgggggctttttgactgcaatg
gtcatccccaatatcggtgcttttattgcctggggatttataacggcattatttattccc
accggctggctgccgaatgaacatttcgccaaaattgttggtccgatgattacctattta
ttgcccgtgatgattggttctaccggtggtcatctggtcggcggtaaacgcggcgcggtc
atgggcggaattggtacgattggtgtgatcgtcggcgctgaaatcccgatgttccttggc
tcgatgattatggggccgctcggtggtctggtgattaaatatatcgacaagtcgctggaa
aaacgcatacctgctggttttgagatggttatcaataacttctcattaggtatcgcgggg
atgctcttttgtctgctgggttttgaagttatcggtccggcggtgttaattgctaatact
ttcgtcaaagagtgtattgaggcgctggtacatgcgggttatctgcctttgctgtcagtc
atcaatgaaccggcgaaagtgcttttccttaataatgcgattgatcagggcgtctattat
ccgctgggaatgcaacaggcttcggttaacggtaaatccatcttcttcatggtggcctcc
aacccaggtcctggtctggggctgctgctggcgtttaccttgtttggtaaagggatgagt
aaacgttctgcgcccggggcgatgattattcacttcctcggtgggatccacgaactgtat
ttcccgtatgtgctgatgaagccgctgaccattattgccatgattgcgggcggtatgtct
ggcacctggatgtttaacttactggacggtggtctggtggctggcccaagtccggggtct
atctttgcttacctggcactgacgccgaaaggctcgttcctggcgacaattgccggtgtt
acggtaggtaccctggtgtcctttgctatcacttcgctgatactgaagatggaaaaaacg
gtggaaacgaagagcgaagatgagtttaccgagtcagccaatgcggttaaggcgatgaaa
caagaaggtgcattctcgttaagccgtgttaagcgtattgcctttgtttgcgatgcaggg
atgggctccagtgcgatgggcgcaaccaccttccgtaaacgcctggaaaaagcggggctg
gcaatagaagtaaaacattacgccatagaaaacgtgcctgcggatgcggatatcgtcgtt
actcacgccagtctggaagggcgcgtgaaacgtgtgacggataaaccactgatattgatt
aataactatattggcgatccaaaactcgacactttatttaatcaattaaccgctgaacat
aaacactga

DBGET integrated database retrieval system