KEGG   Escherichia coli NA114 (UPEC): ECNA114_2979
Entry
ECNA114_2979      CDS       T01998                                 

Definition
(GenBank) putative phage serine protease
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: Band_7
Other DBs
NCBI-ProteinID: AEG37818
Position
3062482..3063390
AA seq 302 aa
MKAPVSITSFRPQKSIAIAIGVLAVVVLPFLSYYTVNEGERGILLRYGKIVKVAEPGLGF
KIPFMESVEKISTRNQAVVYQGLQAYSRDQQPAQMTVSVSFHIKPSEAGAVYTTYNTIEA
LKDRLIVRQLPTQLENVFGQYTAISAVQDRTKLVQDLQNAMRKAVVGPVVIDGVQIENID
FSDAYEKSIEDRMKAEVAIATRKQNLETEKIQAQIAVTQAQAEADSKLAAAKAEAETIRV
RGAAEAETIRLKSAAEAEAIRLRGEALRENPGLVALTTAERWDGKLPDTMIPGSTVPFIS
TK
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaagcacctgtttcaataacctcatttcgcccacaaaaatctattgctatcgccatt
ggcgtgcttgccgtggttgtgctgccatttctctcgtattacaccgttaatgaaggtgaa
cgcggcattttgctgcgctacggaaaaatcgtaaaagttgccgagccggggctgggtttt
aagatcccttttatggaaagtgtagagaaaatttccacgcgtaatcaggctgtggtctat
cagggattacaggcctacagccgcgaccagcaaccggcacaaatgacggtatcagtcagc
ttccacattaaaccttcagaagcaggcgcggtttataccacctacaacaccattgaagca
ttaaaagatcgtctgattgtccgtcagttgccaactcaactggagaacgttttcggccaa
tataccgccatcagcgcggtacaggatcgtacaaaactggttcaggatctgcaaaatgca
atgcgtaaagccgttgttggcccggtggtgattgatggtgtccagattgaaaatattgat
ttttctgacgcttatgaaaagtcgattgaagaccgaatgaaagcagaagtcgccattgcc
acacgtaagcaaaatctggaaacagagaaaatccaagcgcaaatagcagtaactcaggcc
caggcagaagcagacagtaaactggcggcagccaaagcagaagctgagaccattcgcgta
agaggcgcggcagaggctgaaactattcgtttaaaaagtgcggctgaagcagaagctatc
cgcctgcgcggtgaagctctgcgggagaatcccggacttgttgccctcaccactgctgag
cgttgggacggtaaactgcccgataccatgatccccggcagcacagttccgtttatctct
actaagtaa

DBGET integrated database retrieval system