KEGG   Escherichia coli NA114 (UPEC): ECNA114_2980
Entry
ECNA114_2980      CDS       T01998                                 

Gene name
tktA
Definition
(GenBank) Transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00030  Pentose phosphate pathway
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01120  Microbial metabolism in diverse environments
ena01200  Carbon metabolism
ena01230  Biosynthesis of amino acids
Module
ena_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ena_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ECNA114_2980 (tktA)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ECNA114_2980 (tktA)
Enzymes [BR:ena01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ECNA114_2980 (tktA)
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C
Other DBs
NCBI-ProteinID: AEG37819
Structure
PDB: 

Position
complement(3063597..3065588)
AA seq 663 aa
MSSRKELANAIRALSMDAVQKAKSGHPGAPMGMADIAEVLWRDFLKHNPQNPSWADRDRF
VLSNGHGSMLIYSLLHLTGYDLPMEELKNFRQLHSKTPGHPEVGYTAGVETTTGPLGQGI
ANAVGMAIAEKTLAAQFNRPGHDIVDHYTYAFMGDGCMMEGISHEVCSLAGTLKLGKLIA
FYDDNGISIDGHVEGWFTDDTAMRFEAYGWHVIRDIDGHDAASIKRAVEEARAVTDKPSL
LMCKTIIGFGSPNKAGTHDSHGAPLGDAEIALTREQLGWKYAPFEIPSEIYAQWDAKEAG
QAKESAWNEKFAAYAKAYPQEAAEFTRRMKGEMPSDFDAKAKEFIAKLQANPAKIASRKA
SQNAIEAFGPLLPEFLGGSADLAPSNLTLWSGSKAINEDAAGNYIHYGVREFGMTAIANG
ISLHGGFLPYTSTFLMFVEYARNAVRMAALMKQRQVMVYTHDSIGLGEDGPTHQPVEQVA
SLRVTPNMSTWRPCDQVESAVAWKYGVERQDGPTALILSRQNLAQQERTEEQLANIARGG
YVLKDCAGQPELIFIATGSEVELAVAAYEKLTAEGVKARVVSMPSTDAFDKQDAAYRESV
LPKAVTARVAVEAGIADYWYKYVGLNGAIVGMTTFGESAPAEQLFEEFGFTVDNVVAKAK
ALL
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgtcctcacgtaaagagcttgccaatgctattcgtgcgctgagcatggacgcagtacag
aaagccaaatccggtcacccgggtgcccctatgggtatggctgacattgccgaagtcctg
tggcgtgatttcctgaaacacaacccgcagaatccgtcctgggctgaccgtgaccgcttc
gtgctgtccaacggccacggctccatgctgatctacagcctgctgcacctcaccggttac
gatctgccgatggaagaactgaaaaacttccgtcagctgcactctaaaactccgggccac
ccggaagtgggttacaccgcaggtgtagaaaccaccaccggtccgctgggtcagggtatt
gccaacgcagtcggtatggcgattgcagaaaaaacgctggcggcgcagtttaaccgtccg
ggccacgacatcgtcgaccactacacctacgccttcatgggcgacggctgcatgatggaa
ggcatctcccacgaagtttgctctctggcgggtacgctgaagctgggtaaactgattgcg
ttctacgatgacaacggtatttctatcgatggtcacgttgaaggctggtttaccgacgac
accgcaatgcgtttcgaagcttacggctggcacgttattcgcgacatcgacggtcatgac
gcggcatccatcaaacgcgcagtagaagaagcgcgcgcagtgactgacaaaccgtccctg
ctgatgtgcaaaaccatcatcggtttcggttccccgaacaaagccggtacccacgactcc
cacggtgcgccgctgggcgacgctgaaattgccctgacccgcgaacagctgggctggaaa
tacgcgccgttcgaaatcccgtctgaaatctatgctcagtgggatgcgaaagaagcaggc
caggcgaaagagtccgcatggaacgagaaattcgctgcttacgcgaaagcttatccgcag
gaagccgctgaatttacccgccgtatgaaaggcgaaatgccgtctgacttcgacgcgaaa
gcgaaagagttcattgctaaactgcaggctaacccggcgaagatcgccagccgtaaagcg
tctcagaatgctatcgaagcgttcgggccgctgttgccggaattcctcggcggttctgca
gacctggcgccgtctaacctgaccctgtggtctggttctaaagcaatcaacgaagatgct
gcgggtaactacatccactacggtgtacgtgaattcggtatgactgcgattgccaacggt
atctccctgcacggtggtttcctgccgtacacctccaccttcctgatgttcgtggaatac
gcacgtaacgccgtacgtatggctgcgctgatgaaacagcgtcaggtgatggtttacacc
cacgactccatcggtctgggcgaagatggcccgactcaccagccggtagagcaggtcgct
tctctgcgcgtgaccccgaacatgtctacatggcgtccgtgtgaccaggttgaatccgcg
gtagcgtggaaatacggcgttgaacgtcaggacggcccgactgcgcttatcctctcccgt
cagaacctggcgcagcaggaacgtactgaagagcagctggcaaacatcgcgcgcggtggt
tatgtgctgaaagactgtgctggtcagccggaactgatcttcatcgcgaccggttctgaa
gttgaactggctgtagcggcatacgaaaaattgactgccgaaggcgtgaaagcgcgcgtg
gtttccatgccgtctaccgacgcattcgacaagcaggacgcggcttaccgtgaatccgta
ctgccgaaagcggttaccgctcgtgttgcggtggaagctggcattgctgactactggtac
aagtatgttggcctgaacggtgctatcgtcggcatgaccaccttcggtgaatctgctccg
gcagagcagctgtttgaagagttcggcttcaccgttgacaacgttgttgcgaaagcaaaa
gcgctgctgtaa

DBGET integrated database retrieval system