KEGG   Escherichia coli NA114 (UPEC): ECNA114_2981
Entry
ECNA114_2981      CDS       T01998                                 

Gene name
yggG
Definition
(GenBank) Putative metalloprotease
  KO
K07387  metalloprotease [EC:3.4.24.-]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ena01002]
    ECNA114_2981 (yggG)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     ECNA114_2981 (yggG)
Peptidases and inhibitors [BR:ena01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   ECNA114_2981 (yggG)
SSDB
Motif
Pfam: Peptidase_M48
Other DBs
NCBI-ProteinID: AEG37820
Position
3065866..3066624
AA seq 252 aa
MKIRALLVAMSVATVLTGCQNMDSSGLLSSGAEAFQAYSLSDAQVKTLSDQACQDMDSKA
TIAPANSEYAKRLTTISRALGDNINGQPVNYKVYMAKDVNAFAMANGCIRVYSGLMDMMT
DNEVEAVLGHEMGHVALGHVKKGMQVALGTNAIRVAAASAGGIVGSLSQSQLGDLGEKLV
NSQFSQRQEAEADDYSYDLLRQRGISPAGLATSFEKLAKLEEGRQSSMFDDHPASAERAQ
HIRDRMSADGVK
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaaaattcgcgccttattggtagcaatgagcgtggcaacggtactgactggttgccag
aatatggactccagtggactgctctcatcaggagcggaagcttttcaggcttacagtttg
agtgatgcgcaggtgaaaaccctgagcgatcaggcatgtcaggatatggacagcaaggcg
acgattgcgccagccaatagcgaatacgctaaacgtctgacgacaatttctcgcgcgtta
ggcgataacatcaatggtcagccggtgaattacaaagtgtatatggcgaaggatgtgaac
gcctttgcaatggctaacggctgtatccgcgtctatagcgggctgatggatatgatgacg
gataacgaagtcgaagcggtgctcggtcacgaaatggggcacgtggcattaggccatgtg
aagaaaggaatgcaggtagcacttggtacaaacgcaattcgcgttgcggcggcctctgca
ggcggaattgtcggcagtttgtcacaatcacaactaggagacctgggcgaaaagctagtc
aattcgcaattctcccagcgccaggaagcagaggccgatgattactcctacgatttgctg
cgccaacgcggcatcagtccggctggccttgccaccagctttgaaaaactggctaaactg
gaagaaggtcgccaaagttcaatgtttgacgaccacccagcatccgccgaacgcgcccaa
catattcgcgatcgtatgagcgcggatggagttaagtaa

DBGET integrated database retrieval system