KEGG   Escherichia coli NA114 (UPEC): ECNA114_2983
Entry
ECNA114_2983      CDS       T01998                                 

Gene name
speB
Definition
(GenBank) Agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00330  Arginine and proline metabolism
ena01100  Metabolic pathways
Module
ena_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ECNA114_2983 (speB)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     ECNA114_2983 (speB)
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: AEG37822
Position
complement(3066941..3067861)
AA seq 306 aa
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNH
SVQIGIRTEFDKDNGFTVLDACQVNDRSVDDIIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt   +upstreamnt  +downstreamnt
atgagcaccttaggtcatcaatacgataactcactggtttccaacgcctttggtttttta
cgcctgccgatgaacttccagccgtatgacagcgatgctgactgggtgattactggcgtg
ccgttcgatatggccacttctggtcgtgcgggtggtcgtcacggtccggcagcgatccgt
caggtttcgacgaatctggcctgggaacacaaccgcttcccgtggaatttcgacatgcgt
gagcgcctgaacgtcgtggactgcggtgatctggtatatgccttcggcgatgcccgtgag
atgagcgagaagctgcaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccactttgttacgctgccgctgctgcgcgctcatgcgaagcatttc
ggcaaaatggcgttggtacactttgacgcccacaccgatacctatgcgaacggttgtgaa
tttgaccacggcaccatgttctataccgcgccgaaagaaggtctgatcgacccgaatcat
tccgtgcagattggtattcgtaccgagtttgataaagacaacggctttaccgtgctggac
gcctgccaggtgaacgatcgcagcgtggatgacattatcgcccaggtgaaacagattgtg
ggtgatatgccggtttacctgacctttgatatcgactgcctggatcctgcttttgcacca
ggcaccggtacgccggtaattggcggcctgacctccgatcgcgccattaaactggtacgc
ggcctgaaagatctcaacatcgttgggatggacgtagtggaagtggctccggcatacgat
cagtcggaaatcaccgctctggctgcggcgacgctggcgctggagatgctgtatattcag
gcggcgaaaaagggcgagtaa

DBGET integrated database retrieval system