KEGG   Escherichia coli NA114 (UPEC): ECNA114_2984
Entry
ECNA114_2984      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Other DBs
NCBI-ProteinID: AEG37823
Position
complement(3067997..3068728)
AA seq 243 aa
MKKWKLRSALIALAVLLAGCSSNAQYNSSASGNVGTAWGGDVHSTVQGVSAERAWRDPAE
MIVISYSTNVPSGYDRVYSIRINELEYAIRDGNFNSLPITRVYDSSNNEPRYIVHARIGM
NYQLYIRNYSRNTNYEIVATVDGLDVLNGKQGSLNNNGYIVNAGDSLAIKGFRKDKHTEA
AFQFANVADSYAANSAQGDVHNTGVIGFAAFELQGPAQNALPPCSGQAFPADNNGYAPPP
CRK
NT seq 732 nt   +upstreamnt  +downstreamnt
atgaaaaaatggaaattacgtagcgcgttgatagcattagccgtgctgctggccggttgt
tccagtaatgcgcagtataatagcagtgcatcgggtaatgtcggcaccgcctggggtggg
gatgtgcactcaacggttcagggcgtatctgctgaacgagcctggcgcgatccggcagag
atgatcgttattagttattcgactaatgttccttccggctacgaccgcgtttatagtatt
cgtattaacgaactggaatatgctattcgcgatggtaattttaattctctacctattacg
cgggtttatgattcatccaataatgaaccacgctatattgtccatgccagaatcggaatg
aattatcaattatatatccgtaattacagtcgtaacaccaactacgagatcgttgctacg
gttgatggcctggatgtgctgaacggcaagcaaggttcgctgaataacaacggttatatt
gtgaatgccggagattcgttagcgattaaaggattccgcaaagataaacataccgaagcg
gcttttcagttcgccaacgttgctgattcctacgcagccaattcggcgcaaggcgatgtg
cataataccggtgtaatcggctttgccgcctttgaattacaaggcccggcgcaaaacgcg
ctgccgccgtgctctggacaagcgtttccggcagataacaatggctatgcgccaccaccg
tgtcggaaatag

DBGET integrated database retrieval system