KEGG   Escherichia coli NA114 (UPEC): ECNA114_2985
Entry
ECNA114_2985      CDS       T01998                                 

Gene name
speA
Definition
(GenBank) Biosynthetic arginine decarboxylase
  KO
K01585  arginine decarboxylase [EC:4.1.1.19]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00330  Arginine and proline metabolism
ena01100  Metabolic pathways
Module
ena_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ECNA114_2985 (speA)
Enzymes [BR:ena01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.19  arginine decarboxylase
     ECNA114_2985 (speA)
SSDB
Motif
Pfam: Orn_Arg_deC_N Arg_decarb_HB Arg_decarbox_C
Other DBs
NCBI-ProteinID: AEG37824
Structure
PDB: 
3NZQ

Position
complement(3068874..3070772)
AA seq 632 aa
MSSQEASKMLRTYNIAWWGNNYYDVNELGHISVCPDPDVPEARVDLAQLVKTREAQGQRL
PALFCFPQILQHRLRSINAAFKRARESYGYNGDYFLVYPIKVNQHRRVIESLIHSGEPLG
LEAGSKAELMAVLAHAGMTRSVIVCNGYKDREYIRLALIGEKMGHKVYLVIEKMSEIAIV
LDEAERLNVVPRLGVRARLASQGSGKWQSSGGEKSKFGLAATQVLQLVETLREAGRLDSL
QLLHFHLGSQMANIRDIATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDC
SVNYGLNEYANNIIWAIGDACEENGLPHPTVITESGRAVTAHHTVLVSNIIGVERNEYTV
PTAPAEDAPRALQSMWETWQEMHEPGTRRSLREWLHDSQMDLHDIHIGYSSGTFSLQERA
WAEQLYLSMCHEVQKQLDPQNRAHRPIIDELQERMADKMYVNFSLFQSMPDAWGIDQLFP
VLPLEGLDQVPERRAVLLDITCDSDGAIDHYIDGDGIATTMPMPEYDPENPPMLGFFMVG
AYQEILGNMHNLFGDTEAVDVFVFPDGSVEVELSDEGDTVADMLQYVQLDPKTLLTQFRD
QVKKTDLDAELQQQFLEEFEAGLYGYTYLEDE
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgagctcccaggaagccagcaagatgctgcgtacttacaatattgcctggtggggcaat
aactactatgacgttaacgagctgggccacatcagcgtgtgcccggacccggacgtcccg
gaagctcgcgtcgatctcgcgcagttagtgaaaactcgtgaagcacagggccagcgtctg
cctgcactgttctgtttcccgcagatcctgcagcaccgtttgcgttctattaacgccgcg
ttcaaacgtgcgcgggaatcctacggctataacggcgattacttcctcgtttatccgatc
aaagttaaccagcaccgccgcgtgattgagtccctgattcattcgggcgaaccgctgggc
ctggaagccggttccaaagctgagttgatggcggtgctggcacatgctggcatgacccgt
agcgtcatcgtctgcaacggttataaggaccgcgaatatatccgtctggcattaattggc
gagaagatgggccacaaggtctatctggtcattgagaagatgtcagaaattgccattgtg
ctggatgaagcagaacgtctgaatgtcgttcctcgtctgggcgtgcgtgcacgtctggct
tcgcagggctccggtaaatggcagtcctccggcggggaaaaatcgaagttcggcctggcg
gcgactcaggtactgcaactggttgaaaccctgcgtgaagccgggcgtctcgacagcctg
caactgctgcacttccacctcggttcgcagatggcgaatattcgcgatatcgcgacaggc
gttcgtgaatccgcgcgtttctatgttgagctgcacaagctgggcgtcaatattcagtgc
ttcgacgtcggcggcggtctgggcgtggactatgaaggcacccgttcgcagtccgactgt
tcggtgaactacggcctcaatgaatacgccaacaacatcatctgggcgattggtgatgcg
tgtgaagaaaatggtctgccacatccgacggtaatcaccgaatcgggtcgtgcggtgact
gcgcatcacaccgtgctggtgtcgaatatcatcggcgtggaacgtaacgaatacacggtg
ccgaccgcgcctgcagaagacgcaccgcgcgccctgcaaagcatgtgggaaacctggcag
gaaatgcacgaaccgggaactcgccgttctctgcgtgaatggttacacgacagccagatg
gatctgcacgatattcatatcggctactcttccggcacctttagcctgcaagaacgcgca
tgggctgagcagctttatttgagcatgtgccatgaagtgcaaaagcagctggatccgcaa
aaccgtgctcatcgtccgattatcgacgagctgcaggaacgtatggcggacaaaatgtac
gtcaacttctcgctgttccagtcgatgccggatgcgtgggggatcgaccagttgttcccg
gttctgccgctggaagggctggatcaagtgccggaacgccgcgctgtgctgttggatatt
acctgtgactcagacggtgctatcgaccactatattgatggtgacggtattgccacgaca
atgcctatgccggagtacgatccggagaatccgccgatgctcggtttctttatggtcggc
gcatatcaggagatccttggcaacatgcacaacctgttcggtgataccgaagcggttgac
gtgttcgtcttccctgatggtagcgtagaggtagaactgtctgacgaaggcgataccgtg
gcggacatgctgcaatatgtgcagctcgatccgaaaacgctgttaactcagttccgcgat
caggtgaagaaaaccgatcttgatgctgaactgcaacaacagttccttgaagagttcgag
gcaggtttgtacggttatacctatcttgaagatgaataa

DBGET integrated database retrieval system