KEGG   Escherichia coli NA114 (UPEC): ECNA114_2986
Entry
ECNA114_2986      CDS       T01998                                 

Gene name
yqgB
Definition
(GenBank) Hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Motif
Pfam: YqgB
Other DBs
NCBI-ProteinID: AEG37825
Position
complement(3070859..3070990)
AA seq 43 aa
MKKKPVAQLERQHSLLENPCAYGLLSQFQAAIVVNCFTLNKII
NT seq 132 nt   +upstreamnt  +downstreamnt
atgaaaaagaaaccggttgcgcagttggagcgtcagcattcactgctggaaaatccatgt
gcttatgggttgttatcgcagttccaggctgcgatagtcgttaactgttttacacttaat
aaaataatttga

DBGET integrated database retrieval system