KEGG   Escherichia coli NA114 (UPEC): ECNA114_2989
Entry
ECNA114_2989      CDS       T01998                                 

Gene name
metK
Definition
(GenBank) S-adenosylmethionine synthetase
  KO
K00789  S-adenosylmethionine synthetase [EC:2.5.1.6]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena01100  Metabolic pathways
ena01110  Biosynthesis of secondary metabolites
ena01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_2989 (metK)
Enzymes [BR:ena01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.6  methionine adenosyltransferase
     ECNA114_2989 (metK)
SSDB
Motif
Pfam: S-AdoMet_synt_C S-AdoMet_synt_M S-AdoMet_synt_N
Other DBs
NCBI-ProteinID: AEG37828
Structure
PDB: 

Position
3071645..3072799
AA seq 384 aa
MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETYVKTGMVLVGGEITTS
AWVDIEEITRNTVREIGYVHSDMGFDANSCAVLSAIGKQSPDINQGVDRADPLEQGAGDQ
GLMFGYATNETDVLMPAPITYAHRLVQRQAEVRKNGTLPWLRPDAKSQVTFQYDDGKIVG
IDAVVLSTQHSEEIDQKSLQEAVMEEIIKPILPAEWLTSATKFFINPTGRFVIGGPMGDC
GLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAARYVAKNIVAAGLADRCEIQVS
YAIGVAEPTSIMVETFGTEKVPSEQLTLLVREFFDLRPYGLIQMLDLLHPIYKETAAYGH
FGREHFPWEKTDKAQLLRDAAGLK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggcaaaacacctttttacgtccgagtccgtctctgaagggcatcctgacaaaattgct
gaccaaatctctgatgccgttttagacgcgatcctcgaacaggatccgaaagcacgcgtt
gcttgcgaaacctacgtaaaaaccggcatggttttagttggcggcgaaatcaccaccagc
gcctgggtagacatcgaagagatcacccgtaacaccgttcgcgaaattggctatgtacat
tccgacatgggctttgacgctaactcctgtgcggttctgagcgccatcggcaaacagtct
cctgacatcaaccagggcgttgaccgtgccgatccgctggaacagggcgcgggtgaccag
ggtctgatgtttggctacgcaaccaatgaaaccgacgtgctgatgccagcgcctatcacc
tatgcacaccgtctggtacagcgtcaggctgaagtgcgtaaaaacggcactctgccgtgg
ctgcgcccggacgcgaaaagccaggtgactttccagtatgacgacggcaaaatcgttggt
atcgatgctgtcgtgctttccactcagcactctgaagaaatcgaccagaaatcgctgcaa
gaagcggtaatggaagagatcatcaagccgattctgcccgctgaatggctgacttctgcc
accaaattcttcatcaacccgaccggtcgttttgttatcggtggcccgatgggtgactgc
ggtctgactggtcgtaaaatcatcgttgatacctacggcggcatggcacgtcacggtggt
ggtgcattctctggtaaagatccatcaaaagtggaccgttccgcagcgtacgcagcacgt
tatgtcgcgaaaaacatcgttgctgctggcctggccgatcgttgtgaaattcaggtttcc
tacgcaatcggcgtggctgaaccgacctctatcatggtggaaactttcggtaccgagaaa
gtgccttctgaacaactgactctgctggtacgtgagttctttgacctgcgtccatacggt
ctgattcagatgctggatctgctgcacccaatctacaaagaaaccgcagcatacggtcac
tttggtcgcgaacatttcccgtgggaaaaaaccgacaaagcgcagctgctgcgcgatgct
gccggtctgaagtaa

DBGET integrated database retrieval system