KEGG   Escherichia coli NA114 (UPEC): ECNA114_2990
Entry
ECNA114_2990      CDS       T01998                                 

Definition
(GenBank) hypothetical protein
Organism
ena  Escherichia coli NA114 (UPEC)
SSDB
Other DBs
NCBI-ProteinID: AEG37829
Position
3072876..3073076
AA seq 66 aa
MPHPAKSCPHNNIILPEHVLPQIIIATETDYTNHASQIFVIFSYYYSAFTVVTFLFSKVL
IADNSV
NT seq 201 nt   +upstreamnt  +downstreamnt
atgccgcatccggcaaaaagctgcccgcacaataacatcattcttcctgaacacgtttta
ccgcaaattatcatcgctactgaaaccgattacaccaaccacgccagccaaatatttgta
atattttcatattattattcagctttcacagttgttacatttcttttcagtaaagtctta
attgcagataacagcgtttaa

DBGET integrated database retrieval system