KEGG   Escherichia coli NA114 (UPEC): ECNA114_2991
Entry
ECNA114_2991      CDS       T01998                                 

Gene name
galP
Definition
(GenBank) Galactose-proton symporter
  KO
K08137  MFS transporter, SP family, galactose:H+ symporter
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ena02000]
    ECNA114_2991 (galP)
Transporters [BR:ena02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    ECNA114_2991 (galP)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 MFS_2 SHR3_chaperone MFS_1_like MFS_4
Other DBs
NCBI-ProteinID: AEG37830
Position
3073235..3074629
AA seq 464 aa
MPDAKKQGRSNKAMTFFVCFLAALAGLLFGLDIGVIAGALPFIADEFQITSHTQEWVVSS
MMFGAAVGAVGSGWLSFKLGRKKSLMIGAILFVAGSLFSAAAPNVEVLILSRVLLGLAVG
VASYTAPLYLSEIAPEKIRGSMISMYQLMITIGILGAYLSDTAFSYTGAWRWMLGVIIIP
AILLLIGVFFLPDSPRWFAAKRRFVDAERVLLRLRDTSAEAKRELDEIRESLQVKQSGWA
LFKENSNFRRAVFLGVLLQVMQQFTGMNVIMYYAPKIFELAGYTNTTEQMWGTVIVGLTN
VLATFIAIGLVDRWGRKPTLTLGFLVMAAGMGVLGTMMHIGIHSPSAQYFAIAMLLMFIV
GFAMSAGPLIWVLCSEIQPLKGRDFGITCSTATNWIANMIVGATFLTMLNTLGNANTFWV
YAALNVLFILLTLWLVPETKHVSLEHIERNLMKGRKLREIGAHD
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgcctgacgctaaaaaacaggggcggtcaaacaaggcaatgacgtttttcgtctgcttc
cttgctgctctggcgggattactctttggcctggatatcggtgtaattgctggcgcactg
ccgtttattgcagatgaattccagattacttcgcacacgcaagaatgggtcgtaagctcc
atgatgttcggtgcggcagtcggtgcggtgggcagcggctggctctcctttaaactcggg
cgcaaaaagagcctgatgatcggcgcaatcctgtttgttgccggttcactgttctctgcg
gctgcgccaaacgttgaagtactgattctttcccgcgttctgctggggctggcggtgggt
gtggcttcttataccgcaccactgtacctgtcagaaattgcgccggaaaaaattcgcggc
agtatgatctcgatgtatcagttgatgatcactattgggatcctcggtgcttatctttct
gataccgccttcagctacaccggtgcatggcgctggatgctgggtgtgattatcatcccg
gcaattttgctgctgattggtgtcttcttcctgccagacagcccacgttggtttgctgcc
aaacgccgttttgttgatgccgaacgcgtgctgctgcgcctgcgtgacaccagcgcggaa
gcgaaacgtgaactggatgaaatccgtgaaagtttgcaggttaaacagagtggctgggcg
ctgtttaaagagaacagcaacttccgccgcgcggtgttccttggcgtactgttgcaggta
atgcagcaattcaccgggatgaacgtcatcatgtattacgcgccgaaaatcttcgaactg
gcgggttataccaacaccaccgagcaaatgtgggggacggtgattgtcggcctgaccaac
gtacttgccacctttatcgcaatcggccttgttgaccgctggggacgtaaaccaacgcta
acgctgggcttcctggtgatggctgctggcatgggcgtactcggtacaatgatgcatatc
ggtatccactctccgtcggcgcagtatttcgccatcgccatgctgctgatgtttattgtt
ggctttgccatgagtgccggtccgctgatttgggtactgtgctccgaaattcagccgctg
aaaggccgcgattttggcatcacctgctccaccgccaccaactggattgccaacatgatc
gttggcgcaaccttcctgaccatgctcaacacgctgggtaacgccaacaccttctgggtg
tatgcggctctgaacgtactgtttatcctgctgacattgtggctggtaccggaaaccaaa
cacgtttcgctggaacatattgaacgtaatctgatgaaaggtcgtaaactgcgcgaaatc
ggcgctcacgattaa

DBGET integrated database retrieval system