KEGG   Escherichia coli NA114 (UPEC): ECNA114_2992
Entry
ECNA114_2992      CDS       T01998                                 

Gene name
sprT
Definition
(GenBank) sprT protein
  KO
K02742  SprT protein
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    ECNA114_2992 (sprT)
SSDB
Motif
Pfam: SprT-like Zn_ribbon_SprT DUF45 DUF3267 Desulfoferrod_N
Other DBs
NCBI-ProteinID: AEG37831
Position
3074748..3075203
AA seq 151 aa
MRRLREKLAQANLKLGRNYPEPKLSYTQRGTSAGTAWLESYEIRLNPVLLLENSEAFIEE
VVPHELAHLLVWKHFGRVAPHGKEWKWMMESVLGVPARRTHQFELQSVRRNTFPYRCKCQ
EHQLTVRRHNRVVRGEAVYRCVHCGEQLIAK
NT seq 456 nt   +upstreamnt  +downstreamnt
atgcgtcgcctgcgggaaaaactcgcccaggccaacctgaagctagggcgtaactacccg
gagccaaaactctcttacacccagcgcggaacctccgccggaacagcctggctggaaagc
tatgaaatccgcctcaatcccgttttgctgttggaaaacagtgaagcctttattgaagaa
gtggtgccgcacgaactggcacatttgctggtatggaaacatttcggccgcgtagcgcca
catggcaaagagtggaagtggatgatggaaagcgtgctgggcgttcccgcccgtcgtacg
catcagttcgaactgcaatccgtgcgtcgcaacaccttcccctaccgctgcaagtgccag
gagcatcagcttaccgtacgccgccataatcgcgtagttcgtggcgaggccgtctatcgc
tgtgttcactgcggtgaacagctgattgcaaagtaa

DBGET integrated database retrieval system