KEGG   Escherichia coli NA114 (UPEC): ECNA114_2993
Entry
ECNA114_2993      CDS       T01998                                 

Gene name
endA
Definition
(GenBank) Endonuclease I
  KO
K01150  deoxyribonuclease I [EC:3.1.21.1]
Organism
ena  Escherichia coli NA114 (UPEC)
Brite
KEGG Orthology (KO) [BR:ena00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECNA114_2993 (endA)
Enzymes [BR:ena01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.1  deoxyribonuclease I
     ECNA114_2993 (endA)
SSDB
Motif
Pfam: Endonuclease_1
Other DBs
NCBI-ProteinID: AEG37832
Position
3075298..3076005
AA seq 235 aa
MYRYLSIAAVVLSAAFSGPALAEGINSFSQAKAAAVKVHADAPGTFYCGCKINWQGKKGV
VDLQSCGYQVRKNENRASRVEWEHVVPAWQFGHQRQCWQDGGRKNCAKDPVYRKMESDMH
NLQPSVGEVNGDRGNFMYSQWNGGEGQYGQCAMKVDFKEKAAEPPARARGAIARTYFYMR
DQYNLTLSRQQTQLFNAWNKMYPVTDWECERDERIAKVQGNHNPYVQRACQARKS
NT seq 708 nt   +upstreamnt  +downstreamnt
atgtaccgttatttgtctattgctgcggtggtactgagcgcagcattttccggcccggcg
ttggccgaaggtatcaatagtttttctcaggcgaaagccgcggcggtaaaagtccacgct
gacgcgcccggtacgttttattgcggatgtaaaattaactggcagggcaaaaaaggcgtt
gttgatctgcaatcgtgcggctatcaggtgcgcaaaaatgaaaaccgcgccagccgcgta
gagtgggaacacgtcgttcccgcctggcaattcggtcaccagcgccagtgctggcaggac
ggtggacgtaaaaactgcgctaaagatccggtctatcgcaagatggaaagcgatatgcat
aacctgcagccgtcagtcggcgaggtgaatggcgatcgcggcaactttatgtacagccag
tggaatggcggcgaaggccagtacggtcaatgcgccatgaaggtcgatttcaaagaaaaa
gctgccgaaccaccagcgcgtgcacgcggtgccattgcgcgcacctacttctatatgcgt
gaccaatacaacctgacactctctcgccagcaaacgcagctgttcaacgcatggaacaag
atgtatccggttaccgactgggagtgcgagcgcgatgaacgcatcgcgaaggtgcagggc
aatcataacccgtatgtgcaacgcgcttgccaggcgcgaaagagctaa

DBGET integrated database retrieval system