KEGG   Escherichia coli NA114 (UPEC): ECNA114_2995
Entry
ECNA114_2995      CDS       T01998                                 

Gene name
gshB
Definition
(GenBank) Glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
ena  Escherichia coli NA114 (UPEC)
Pathway
ena00270  Cysteine and methionine metabolism
ena00480  Glutathione metabolism
ena01100  Metabolic pathways
Module
ena_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:ena00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECNA114_2995 (gshB)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ECNA114_2995 (gshB)
Enzymes [BR:ena01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     ECNA114_2995 (gshB)
SSDB
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATP-grasp_3 ATPgrasp_ST
Other DBs
NCBI-ProteinID: AEG37834
Structure
PDB: 
1GSA 1GSH 2GLT 1GLV

Position
3076829..3077779
AA seq 316 aa
MIKLGIVMDPIANINIKKDSSFAMLLEAQRRGYELHYMEMGDLYLINGEARAHTRTLNVK
QNYEEWFSFVGEQDLPLADLDVILMRKDPPFDTEFIYATYILERAEEKGTLIVNKPQSLR
DCNEKLFTAWFSDLTPETLVTRNKAQLKAFWEKHSDIILKPLDGMGGASIFRVKEGDPNL
GVIAETLTEHGTRYCMAQNYLPAIKDGDKRVLVVDGEPVPYCLARIPQGGETRGNLAAGG
RGEPRPLTESDWKIARQVGPTLKEKGLIFVGLDIIGDRLTEINVTSPTCIREIEAEFPVS
ITGMLMDAIEARLQQQ
NT seq 951 nt   +upstreamnt  +downstreamnt
atgatcaagctcggcatcgtgatggaccccatcgcaaacatcaacatcaagaaagattcc
agtttcgctatgttgctggaagcacagcgtcgtggttacgaacttcactatatggagatg
ggcgatctgtatctgatcaatggcgaagcccgcgcccatacccgcacgctgaacgtgaag
cagaactacgaagagtggttttcgttcgtcggtgaacaggatctgccgctggccgatctc
gacgtgatcctgatgcgtaaagacccgccgtttgataccgagtttatctacgcgacctat
attctggaacgtgccgaagagaaagggacgctgatcgttaacaagccgcagagcctgcgc
gactgtaacgagaaactgtttactgcctggttctctgacttaacgccagaaacgctggtt
acgcgcaataaagcgcagctaaaagcgttctgggagaaacacagcgacatcattcttaag
ccactggacggtatgggcggcgcgtcgattttccgcgtgaaagaaggcgatccaaacctc
ggcgtgattgccgaaaccctgactgagcatggcactcgctactgcatggcgcaaaattac
ctgccagccattaaagatggcgacaaacgcgtgctggtggtagatggcgagccggtaccg
tactgcctggcgcgtattccgcaggggggcgaaacccgtggcaatctggctgccggtggt
cgcggtgaacctcgtccgctgacggaaagtgactggaaaatcgcccgtcaggtcgggccg
acgctgaaagaaaaagggctgatttttgttggtctggatatcatcggcgaccgtctgact
gaaattaacgtcaccagcccaacctgtattcgtgagattgaagcagagtttccggtgtcg
atcaccggaatgttaatggatgccatcgaagcacgtttacagcagcagtaa

DBGET integrated database retrieval system